Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2055 bp · TkA07G268970|TK1151|cDNA
ATTTAAACAAGATATTGTGCTCCTAGTTTATCTTTGGTATGATAAATTTTGATTGATTGGACCTTGGCCAATGATGTTTGATGCTTACGGCGTGAGGCCGTGAGCTATATATATTTTTTTAAGATGGTTGATATATAGAACTATAAAATAGAATCATTGCTTAGGTATTGTTAATTTTTCTGAAACTAAGATATCTGGAGTCTGCTTAGAAATCAGAATATCAATACTCCCAAAAATGGGGAACGCTGGGTCTTTCTTTA...
828 bp · TkA07G268970|TK1151|CDS
ATGGTATTTCACGAATGGAGCTCAACTGTACCACACTGGGGAAGAATCAAACCCGGTTGCGGTCGAACCAACCGGGTCGAACCTCCGCAAGGTGGTTCGAACGATGGCACATACTGGCTCGATCTCCCAGTTGATGAAACCGAGAAGGAAAGAGTCAAGAAAGGTGAGTTACAAACCTGTGAAGCTTATATTCATGTCAAACCAGCGCTTGGAGCCACATTTACAGATCTAGCTATTTGGATATTCTACCCTTACAATGG...
Protein
Download Protein FASTA275 aa · TkA07G268970|TK1151|PROTEIN
MVFHEWSSTVPHWGRIKPGCGRTNRVEPPQGGSNDGTYWLDLPVDETEKERVKKGELQTCEAYIHVKPALGATFTDLAIWIFYPYNGPSTAKFGLVDIPLGRIGEHIGDWEHVTLRVSNFDGVLYRVYFAQHSGGTWVDTPLLEFLDSSNGFAAYPSLNGHATYPTAGLVMQGTDVIGIKNDAAKSEKFFDVRDRYVVMAAEYTGDVIELPWVNYNRKWGPKITYEIGTEIERLQNSGTVGSAIGSLVNIIPKEFSSEDG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G268970 |
|---|---|
| TK1151 ID | TkA07G268970 |
| OH-1004 ID | LXL04_029064 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 89.818 / OH-1004 45.238Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G268970 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr07:67191461-67193878 (+) | ||||||
| Description | Protein of unknown function | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | No functional description available | ||||||
| KEGG gene cross-reference | ath:AT1G04090 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06101Vps6229-274 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G268970 | PF06101 | Vps62 | 29 | 274 | 1.5e-109 | 367.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q501D1 | Arabidopsis thaliana | sp|Q501D1|Y1490_ARATH Hypothetical protein At1g04090 | 47.500% | Swiss-Prot | Medium |