Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1044 bp · TkA07G264950|TK1151|cDNA
ATGCAGCTTGCTGGTTGCAAATCTGATAGCCCTCAATCCGCTGCCTTTGACCGTGGAGGTAAAGGTCCGTATGTGGGGGTCGCAGATGGTCGGATCCTAATATGGCAAGGCCCCACAACTGGCTTCGTTGATTTTGCCTACACTTCACCTAACAGGACCAAGAGCTTATGTGATGCTGGCAAGATCGCTGGTCTCCCTATGGGAGGTCCAGTGTTCGAACCTTCTGGACAGCGTGATGCACCGGGTTTTAATAACCCAGG...
1044 bp · TkA07G264950|TK1151|CDS
ATGCAGCTTGCTGGTTGCAAATCTGATAGCCCTCAATCCGCTGCCTTTGACCGTGGAGGTAAAGGTCCGTATGTGGGGGTCGCAGATGGTCGGATCCTAATATGGCAAGGCCCCACAACTGGCTTCGTTGATTTTGCCTACACTTCACCTAACAGGACCAAGAGCTTATGTGATGCTGGCAAGATCGCTGGTCTCCCTATGGGAGGTCCAGTGTTCGAACCTTCTGGACAGCGTGATGCACCGGGTTTTAATAACCCAGG...
Protein
Download Protein FASTA347 aa · TkA07G264950|TK1151|PROTEIN
MQLAGCKSDSPQSAAFDRGGKGPYVGVADGRILIWQGPTTGFVDFAYTSPNRTKSLCDAGKIAGLPMGGPVFEPSGQRDAPGFNNPGGCGGAEFRTAPLGCLEPGTSPEIWRRGCAFPLIHPPVPKKTSDLYIVDAFFGLLVVGFNGGLATQLSGRYKYLSGIDVESYTGNVYFTDASLTYDIRSSFDMSCILSGDTTKPGFKPDSTGRLLKYDPRTQRVTVLLSGLSGVGGPAVSSDRKYVLVPDYVNNKIHRHWLQGP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G264950 |
|---|---|
| TK1151 ID | TkA07G264950 |
| OH-1004 ID | LXL04_029042 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 77.700 |
| Protein coverage (%) | TK1151 97.118 / OH-1004 76.438Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G264950 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:66211968-66213464 (+) | |||||||||
| Description | Similar to SSL12: Protein STRICTOSIDINE SYNTHASE-LIKE 12 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009611 response to wounding Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0009821 alkaloid biosynthetic process Biological Process GO:0035834 indole alkaloid metabolic process Biological Process GO:0051365 cellular response to potassium ion starvation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005773 vacuole Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component | |||||||||
| KEGG gene cross-reference | ag:CAA37671 ag:CAA44208 ath:AT1G74000 ath:AT1G74020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08450SGL8-39 aaPF03088Str_synth162-259 aaPF08450SGL195-303 aaPF01731Arylesterase218-259 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G264950 | PF08450 | SGL | 8 | 39 | 0.012 | 16.0 |
| TkA07G264950 | PF03088 | Str_synth | 162 | 259 | 1.3e-18 | 67.6 |
| TkA07G264950 | PF08450 | SGL | 195 | 303 | 0.012 | 16.0 |
| TkA07G264950 | PF01731 | Arylesterase | 218 | 259 | 0.12 | 11.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.