TkA07G264570 | RubberDandelionOmics

Gene overview

TkA07G264570

Reference: TK1151 Chr: Chr07 Coordinates: 66132967-66142212 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2415 bp · TkA07G264570|TK1151|cDNA

CGCAGTTGCTTTCTGGTGAGAGAAAGAAAAAGATAAACATGACTAATGGTTATCCTTTTTATTTCGAACATCAAGCTTGAAGCTCTCAACTTTGTTTCCAGTCGGTTATCTTTCTACCATCAAAATGATGCACCTCACAAATAAATTTGAACACTTGAAGATACAGTTAGAAGCTATAAAATTAGCGACCAACAACTTTGCTGACGAAAATTGCATCGGTAGAGGAGGTTTTGGTAAAGTATATAAGGGAGAGCTTTTTC...

CDS

Download CDS FASTA

2157 bp · TkA07G264570|TK1151|CDS

ATGATGCACCTCACAAATAAATTTGAACACTTGAAGATACAGTTAGAAGCTATAAAATTAGCGACCAACAACTTTGCTGACGAAAATTGCATCGGTAGAGGAGGTTTTGGTAAAGTATATAAGGGAGAGCTTTTTCACTCCGGTGGGCAAATAGTTGTTGCTTTAAAGAGATTAGATCCAAAATTTGGGCAAGGAAACCCTGAGTTTTGGAAGGAGATCATCATGCTTTCTCAATACAAGCATGAAAATATCGTTTCACT...

Protein

Download Protein FASTA

718 aa · TkA07G264570|TK1151|PROTEIN

MMHLTNKFEHLKIQLEAIKLATNNFADENCIGRGGFGKVYKGELFHSGGQIVVALKRLDPKFGQGNPEFWKEIIMLSQYKHENIVSLLGFCDESNEKILVYEYASRRSLDSYLNNDDLTWIRRLNICIGAARGLAYLHNPGETQQRVLHRDIKSSNILLDENWNAKISDLGLSKFGPANQQYTFLVSNAVGTLGYCDPLYIETGLLTKESDVYSFGVVLFEVLCGRLCISNKNGIHESLTGLVRKYYPQNKISDIIFGNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G264570`
TK1151 ID	TkA07G264570
OH-1004 ID	LXL04_017665
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.100
Protein coverage (%)	TK1151 99.164 / OH-1004 99.695 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G264570

Location Chr07:66132967-66142212 (-)

Description Similar to PTI1: Pto-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47060`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (Probable).	The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g17410`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	CARK1 mediates ABA signaling by phosphorylation of ABA receptors.2018 · DOI: 10.1038/s41421-018-0029-y The Expression of CARK1 or RCAR11 Driven by Synthetic Promoters Increases Drought Tolerance in Arabidopsis thaliana .2018 · DOI: 10.3390/ijms19071945 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g62220`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At1g48210`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G48210

ath:AT3G17410

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.701

Rank 1 · TkA07G264570 · TK1151

Cytoplasm0.245

Rank 2 · TkA07G264570 · TK1151

Nucleus0.181

Rank 3 · TkA07G264570 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA07G264570 · TK1151

Golgi apparatus0.033

Rank 5 · TkA07G264570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase27-294 aa

PF07714PK_Tyr_Ser-Thr29-296 aa

PF21477FERM_C_FAK1119-148 aa

PF01636APH140-164 aa

PF17667Pkinase_fungal144-162 aa

PF00069Pkinase432-639 aa

PF07714PK_Tyr_Ser-Thr434-706 aa

PF21477FERM_C_FAK1530-557 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G264570	`PF00069`	Pkinase	27	294	3.3e-77	260.2
TkA07G264570	`PF07714`	PK_Tyr_Ser-Thr	29	296	8.1e-87	291.5
TkA07G264570	`PF21477`	FERM_C_FAK1	119	148	0.2	13.0
TkA07G264570	`PF01636`	APH	140	164	0.048	14.1
TkA07G264570	`PF17667`	Pkinase_fungal	144	162	0.00077	19.0
TkA07G264570	`PF00069`	Pkinase	432	639	3.3e-77	260.2
TkA07G264570	`PF07714`	PK_Tyr_Ser-Thr	434	706	8.1e-87	291.5
TkA07G264570	`PF21477`	FERM_C_FAK1	530	557	0.2	13.0
TkA07G264570	`PF17667`	Pkinase_fungal	540	626	0.00077	19.0
TkA07G264570	`PF01636`	APH	554	571	0.048	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80719`	Arabidopsis thaliana	sp\|O80719\|CARK3_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 3	75.700%	Swiss-Prot	Low
`Q9LUT0`	Arabidopsis thaliana	sp\|Q9LUT0\|CARK1_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 1	75.500%	Swiss-Prot	Low
`Q9M1Q2`	Arabidopsis thaliana	sp\|Q9M1Q2\|CARK2_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 2	73.600%	Swiss-Prot	Low
`F4HWU0`	Arabidopsis thaliana	sp\|F4HWU0\|CAK11_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 11	74.800%	Swiss-Prot	Low
`Q9LX66`	Arabidopsis thaliana	sp\|Q9LX66\|HERK_ARATH Receptor-like protein kinase HERK 1	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card