Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1292 bp · TkA07G260840|TK1151|cDNA
GTCTAGTTTTGATCCATTTGTATAGTAAGGATCAAATTAATTGTATATATCATCGCCACAAATTTTAAAAAAGTATATCTTCTAGAAAAAAAAAAATTAACGAGGAATTTGAGTTTGAGTTTGAGTTTGTGGCGAGGGAGATTGAACATAGAAGCAGAACGTGGAGGGAACAGCACGAATCCTGGAGCTAAGAAAAATCTACCCATGCTAATCCTCCAAACATGGATTCAACAAAAACGAACAAGATGCAATTTTTCTCC...
648 bp · TkA07G260840|TK1151|CDS
ATGGGCGACGGTGCACCCACGGGTTCCGTACCAACATCAAAGCTGGAAGCCCAAATACTAGAGGCAGTATTACAACGAGAGCTGAAAGGAACTTCCATAAAGTCATTCAACAAGATAATCTTGAAATTTCCAAAAATCGACGAGAGCCTAAGAAAATGCAAAGTTATATTCGAACAGTTTGACGAGGATAAAAGCGGTGCAATTGATCTTAAAGAGCTGAAGAACTGTTTCAGTAAGCTTGAAGTGACCTTCACAAACGA...
Protein
Download Protein FASTA215 aa · TkA07G260840|TK1151|PROTEIN
MGDGAPTGSVPTSKLEAQILEAVLQRELKGTSIKSFNKIILKFPKIDESLRKCKVIFEQFDEDKSGAIDLKELKNCFSKLEVTFTNEEISDIFQACDLNDDMGIDFHEFIVLLCLVYLLKEGSSAPNSKSRMGIPDLEATFETLVESFVFLDNNNDGYISKNEMIHAIEESGRSDGQITMKRFEEMDWDKNGTVNFKEFLFAFTSWVGIQDDEDD
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G260840 |
|---|---|
| TK1151 ID | TkA07G260840 |
| OH-1004 ID | LXL04_029002 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 95.133Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G260840 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:65205480-65207256 (+) | |||||||||
| Description | Similar to CML21: Probable calcium-binding protein CML21 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009617 response to bacterium Biological Process GO:0009751 response to salicylic acid Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0051592 response to calcium ion Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function GO:0005509 calcium ion binding Molecular Function GO:0005516 calmodulin binding Molecular Function GO:0005524 ATP binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G24110 ath:AT4G04695 ath:AT4G04700 ath:AT4G26470 dosa:Os05g0491900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14658EF-hand_93-25 aaPF21008AIF-146-112 aaPF25578EF-hand_STIM151-75 aaPF25825SAPC2_N51-109 aaPF13155Toprim_251-101 aaPF13499EF-hand_752-110 aaPF13833EF-hand_852-77 aaPF00036EF-hand_153-80 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G260840 | PF14658 | EF-hand_9 | 3 | 25 | 0.015 | 16.5 |
| TkA07G260840 | PF21008 | AIF-1 | 46 | 112 | 1.3e-05 | 26.2 |
| TkA07G260840 | PF25578 | EF-hand_STIM1 | 51 | 75 | 0.0004 | 21.1 |
| TkA07G260840 | PF25825 | SAPC2_N | 51 | 109 | 0.024 | 15.2 |
| TkA07G260840 | PF13155 | Toprim_2 | 51 | 101 | 0.045 | 14.9 |
| TkA07G260840 | PF13499 | EF-hand_7 | 52 | 110 | 1.5e-18 | 67.6 |
| TkA07G260840 | PF13833 | EF-hand_8 | 52 | 77 | 1.5e-11 | 44.6 |
| TkA07G260840 | PF00036 | EF-hand_1 | 53 | 80 | 1.3e-20 | 72.1 |
| TkA07G260840 | PF23564 | EF-hand_FSTL1 | 53 | 114 | 2.5e-08 | 35.1 |
| TkA07G260840 | PF13405 | EF-hand_6 | 54 | 79 | 2.1e-19 | 68.0 |
| TkA07G260840 | PF12763 | EH | 54 | 74 | 4.6e-05 | 24.0 |
| TkA07G260840 | PF10591 | SPARC_Ca_bdg | 55 | 110 | 6e-06 | 27.2 |
| TkA07G260840 | PF13202 | EF-hand_5 | 56 | 76 | 9.4e-13 | 47.7 |
| TkA07G260840 | PF12763 | EH | 56 | 124 | 4.6e-05 | 24.0 |
| TkA07G260840 | PF14658 | EF-hand_9 | 56 | 77 | 0.015 | 16.5 |
| TkA07G260840 | PF05042 | Caleosin | 60 | 83 | 0.14 | 12.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.