TkA07G255530 | RubberDandelionOmics

Gene overview

TkA07G255530

Reference: TK1151 Chr: Chr07 Coordinates: 63892481-63895875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2727 bp · TkA07G255530|TK1151|cDNA

GTAATTCACCGTTTTTCCCACACCACAGTTTCAGCTCATTCAATTCCTAGAAGGCCCTCTCTCTCCTCCACTCTGGTCAAACACAATTCTATAGATTCCCAAAATCTCGTTGGGTTCTGCATTGTGATCGATCAATTCACATACAAATGCATCTTTATATTCATCACAGAAGGGTTCTAAATTTAGCAGCCACAAGAAAAAAACCACAGTTTTTGAAGTAAAAATGCAAGGAATCCATCTGGGTATCGGTCTATCTTCGT...

CDS

Download CDS FASTA

2187 bp · TkA07G255530|TK1151|CDS

ATGGACTTCATGAAAGAGAAGCAAGTCAGGTTTTACCCCGGCGAAAATGGAAAGTCAAACTTCGAACACTCATGGAAAATCCCCGAAAAACAATTACCAGACCACAAGATCTCAGCTCCATTGTTGATCAATGGTGGTAAAAGTCATATGGGTATTAAATTGGGGAAATCGAGAGTTCACCCAGAAGAAATCACCAATTTAAACGGCAAAAGGATTTTGGATCCTGGAAGTGAAGTTATCTTACAATGGAACAGAATGTT...

Protein

Download Protein FASTA

728 aa · TkA07G255530|TK1151|PROTEIN

MDFMKEKQVRFYPGENGKSNFEHSWKIPEKQLPDHKISAPLLINGGKSHMGIKLGKSRVHPEEITNLNGKRILDPGSEVILQWNRMFLFSCLVALFVDPLFFYLPSAQNNGGSSCMLSDLNLGIVVTCLRTIADVFYMLHIFIKFRTAYVSPSSRVLGRGELVMDPEKIARRYLKSDFFIDLVATLPLPQIVIWFIIPAIRTQHADHTTNALGLIVLLQYIPRFYLIFPLSSQIIKATGVFTKTAWAGAAYNLVLYMLAS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G255530`
TK1151 ID	TkA07G255530
OH-1004 ID	LXL04_028971
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G255530

Location Chr07:63892481-63895875 (-)

Description Similar to CNGC14: Probable cyclic nucleotide-gated ion channel 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24610`	Probable cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At4g30360`	Probable cyclic nucleotide-gated ion channel.	Phytosulfokine Regulates Growth in Arabidopsis through a Response Module at the Plasma Membrane That Includes CYCLIC NUCLEOTIDE-GATED CHANNEL17, H+-ATPase, and BAK1.2015 · DOI: 10.1105/tpc.15.00306
`At5g14870`	Cyclic nucleotide-gated ion channel required for directional pollen tube growth into the transmitting tract.	A cyclic nucleotide-gated channel is essential for polarized tip growth of pollen.2007 · DOI: 10.1073/pnas.0701781104 Cyclic nucleotide-gated channel 18 is an essential Ca2+ channel in pollen tube tips for pollen tube guidance to ovules in Arabidopsis.2016 · DOI: 10.1073/pnas.1524629113
`At3g48010`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release
`At2g28260`	Putative cyclic nucleotide-gated ion channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071249 cellular response to nitrate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

KEGG gene cross-reference

ath:AT2G24610

ath:AT2G28260

ath:AT3G48010

ath:AT4G30360

ath:AT5G14870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884

Rank 1 · TkA07G255530 · TK1151

Cytoplasm0.085

Rank 2 · TkA07G255530 · TK1151

Endoplasmic reticulum0.059

Rank 3 · TkA07G255530 · TK1151

Nucleus0.028

Rank 4 · TkA07G255530 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA07G255530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans83-408 aa

PF18215Rtt106_N427-441 aa

PF18215Rtt106_N455-469 aa

PF00027cNMP_binding504-591 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G255530	`PF00520`	Ion_trans	83	408	4.6e-21	75.8
TkA07G255530	`PF18215`	Rtt106_N	427	441	0.062	13.9
TkA07G255530	`PF18215`	Rtt106_N	455	469	0.062	13.9
TkA07G255530	`PF00027`	cNMP_binding	504	591	1.1e-06	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJA4`	Arabidopsis thaliana	sp\|Q9SJA4\|CNG14_ARATH Probable cyclic nucleotide-gated ion channel 14	65.500%	Swiss-Prot	High
`Q8L7Z0`	Arabidopsis thaliana	sp\|Q8L7Z0\|CNG17_ARATH Cyclic nucleotide-gated ion channel 17	63.900%	Swiss-Prot	High
`Q9LEQ3`	Arabidopsis thaliana	sp\|Q9LEQ3\|CNG18_ARATH Cyclic nucleotide-gated ion channel 18	59.900%	Swiss-Prot	High
`Q9SU64`	Arabidopsis thaliana	sp\|Q9SU64\|CNG16_ARATH Probable cyclic nucleotide-gated ion channel 16	59.400%	Swiss-Prot	High
`Q9SL29`	Arabidopsis thaliana	sp\|Q9SL29\|CNG15_ARATH Putative cyclic nucleotide-gated ion channel 15	59.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card