TkA07G252090 | RubberDandelionOmics

Gene overview

TkA07G252090

Reference: TK1151 Chr: Chr07 Coordinates: 62886135-62890748 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · TkA07G252090|TK1151|cDNA

CTTTTTTTAAGTTTAACCTTGATAGGTTGATACTTGATAGTGTAATTTGGTATTTGGTGGGGGCTAAGCCGAGATCCTGAAATGGGAATGGCCCAATTCGAATAAGGTTTTGTGTCTTCGTTTCTGCGAATCAATATCAACACACGACTGAGTTCTCGTTCACGTTGCGCTGCTGCGTGCATAGCTTCAAGGGACACAGGGTTTTAGAAGATGCAGCGATTCAGATCCTTATTAGTACTTAGGCGTCCGTTGCAGAGACA...

CDS

Download CDS FASTA

1203 bp · TkA07G252090|TK1151|CDS

ATGCAGCGATTCAGATCCTTATTAGTACTTAGGCGTCCGTTGCAGAGACAGTCTCACAATTCCTACACCACCATTTCTGCTCAACGTGACACCTCCCCTCAACACCACCATTTTCATGAAGAGGTTTTGGTGGAAGGAAGAGCTTTCTCGAGGGCTGCCATACTCAATAGACCATCTCAACTCAATGCTATTACTACCTCTATGGCTGGTCGATTACAAAGGCTTTACCAGTCATGGGAGGATAATTCTCAAATTGGATT...

Protein

Download Protein FASTA

400 aa · TkA07G252090|TK1151|PROTEIN

MQRFRSLLVLRRPLQRQSHNSYTTISAQRDTSPQHHHFHEEVLVEGRAFSRAAILNRPSQLNAITTSMAGRLQRLYQSWEDNSQIGFVMMKGSGRAFCSGADMVTIHRLLQEGNVAECKEFFRTLYQFIYLLGTYLKPNLAILDGITMGGGAGVAVPGMFRIATDKTVFATPEVQMGFHPDAGASFYLSRLPGYLGEFLALTGEKLNGAELVACGIATHYSLSGKLGWIEERLGQLMTDDPSVISDSLAQYGDLVYVDKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G252090`
TK1151 ID	TkA07G252090
OH-1004 ID	LXL04_028937
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G252090

Location Chr07:62886135-62890748 (+)

Description Similar to At4g31810: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31810`	Small ribosomal subunit protein mS47.	No verified direct reference in this release
`At3g60510`	3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial.	No verified direct reference in this release
`At2g30660`	Involved in valine catabolism.	No verified direct reference in this release
`At5g65940`	Involved in valine catabolism.	Arabidopsis Chy1 null mutants are deficient in benzoic acid-containing glucosinolates in the seeds.2009 · DOI: 10.1111/j.1438-8677.2008.00160.x
`At2g30650`	Involved in valine catabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028937 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009536 plastid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G30650

ath:AT2G30660

ath:AT3G60510

ath:AT4G31810

ath:AT5G65940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.888

Rank 1 · TkA07G252090 · TK1151

Cytoplasm0.087

Rank 2 · TkA07G252090 · TK1151

Nucleus0.052

Rank 3 · TkA07G252090 · TK1151

Plastid0.031

Rank 4 · TkA07G252090 · TK1151

Cell membrane0.019

Rank 5 · TkA07G252090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16113ECH_251-379 aa

PF00378ECH_155-217 aa

PF14591AF0941-like231-303 aa

PF00378ECH_1273-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G252090	`PF16113`	ECH_2	51	379	3.7e-114	382.4
TkA07G252090	`PF00378`	ECH_1	55	217	2.3e-21	77.0
TkA07G252090	`PF14591`	AF0941-like	231	303	0.043	15.1
TkA07G252090	`PF00378`	ECH_1	273	293	2.3e-21	77.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXN4`	Arabidopsis thaliana	sp\|Q8RXN4\|HIBC5_ARATH Small ribosomal subunit protein mS47	63.200%	Swiss-Prot	High
`Q5XF59`	Arabidopsis thaliana	sp\|Q5XF59\|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial	58.600%	Swiss-Prot	High
`Q6NMB0`	Arabidopsis thaliana	sp\|Q6NMB0\|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3	44.500%	Swiss-Prot	Medium
`Q9LKJ1`	Arabidopsis thaliana	sp\|Q9LKJ1\|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1	44.500%	Swiss-Prot	Medium
`Q1PEY5`	Arabidopsis thaliana	sp\|Q1PEY5\|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2	44.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card