TkA07G247980 | RubberDandelionOmics

Gene overview

TkA07G247980

Reference: TK1151 Chr: Chr07 Coordinates: 61873860-61875963 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · TkA07G247980|TK1151|cDNA

ATGAACTGGGCACATCACGGATCTATCTGGCCTATGACCTTCGGCCTTGCTCATCCCGATTTCATAGGCAGGGATCCTAACCGGGAGAAAGGAGATTTGAAACACAAAAACTGGTCATCATCAGGTCAAGTTGATGGACTCTGTAAACTACTTGACCAAAACAAAGACACTCTATCAACCCTTGAATTTCTACATTGCAAACTTCCAGCATCTCTTGTGACTGCAATTTGTGAATCCTTATTTATAAAAGGCTTTGAAAC...

CDS

Download CDS FASTA

855 bp · TkA07G247980|TK1151|CDS

ATGAACTGGGCACATCACGGATCTATCTGGCCTATGACCTTCGGCCTTGCTCATCCCGATTTCATAGGCAGGGATCCTAACCGGGAGAAAGGAGATTTGAAACACAAAAACTGGTCATCATCAGGTCAAGTTGATGGACTCTGTAAACTACTTGACCAAAACAAAGACACTCTATCAACCCTTGAATTTCTACATTGCAAACTTCCAGCATCTCTTGTGACTGCAATTTGTGAATCCTTATTTATAAAAGGCTTTGAAAC...

Protein

Download Protein FASTA

284 aa · TkA07G247980|TK1151|PROTEIN

MNWAHHGSIWPMTFGLAHPDFIGRDPNREKGDLKHKNWSSSGQVDGLCKLLDQNKDTLSTLEFLHCKLPASLVTAICESLFIKGFETNVIQSFSIKRSSFLDSSFFPLPLGLESLLIASSVLTKLTLSDNHLWWKTAKILFDTLLETESGLQVLDLSENNISDCGLPDETLEMILDNVAGKERLGCFVADDVLCAAKDPIQPVFCIPWAIWSEYAGEGLCHQGHFRNHAVFLGCRGHLLLLLIKKQSRYYAANRGWGWVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G247980`
TK1151 ID	TkA07G247980
OH-1004 ID	LXL04_018696
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.900
Protein coverage (%)	TK1151 43.310 / OH-1004 19.935 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G247980`
Location	Chr07:61873860-61875963 (-)
Description	Similar to NLRP5: NACHT, LRR and PYD domains-containing protein 5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018696` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0007015 actin filament organization Biological Process GO:0032880 regulation of protein localization Biological Process GO:0040019 positive regulation of embryonic development Biological Process GO:0051293 establishment of spindle localization Biological Process GO:0051302 regulation of cell division Biological Process GO:0051656 establishment of organelle localization Biological Process GO:0140089 protein storage Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	bta:493717 cbr:CBG_23501 cel:CELE_F28C1.3 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.470

Rank 1 · TkA07G247980 · TK1151

Cytoplasm0.425

Rank 2 · TkA07G247980 · TK1151

Mitochondrion0.123

Rank 3 · TkA07G247980 · TK1151

Cell membrane0.075

Rank 4 · TkA07G247980 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA07G247980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29265LRR_CARMIL38-65 aa

PF00560LRR_158-73 aa

PF12799LRR_461-65 aa

PF29265LRR_CARMIL119-166 aa

PF29255LRR_NLRC3120-166 aa

PF13516LRR_6120-132 aa

PF00560LRR_1122-133 aa

PF13855LRR_8122-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G247980	`PF29265`	LRR_CARMIL	38	65	0.11	11.9
TkA07G247980	`PF00560`	LRR_1	58	73	0.0025	18.3
TkA07G247980	`PF12799`	LRR_4	61	65	0.14	13.2
TkA07G247980	`PF29265`	LRR_CARMIL	119	166	0.11	11.9
TkA07G247980	`PF29255`	LRR_NLRC3	120	166	0.095	12.1
TkA07G247980	`PF13516`	LRR_6	120	132	0.13	13.1
TkA07G247980	`PF00560`	LRR_1	122	133	0.0025	18.3
TkA07G247980	`PF13855`	LRR_8	122	132	0.044	14.3
TkA07G247980	`PF13855`	LRR_8	122	162	0.044	14.3
TkA07G247980	`PF12799`	LRR_4	122	132	0.14	13.2
TkA07G247980	`PF00560`	LRR_1	151	164	0.0025	18.3
TkA07G247980	`PF13516`	LRR_6	151	165	0.13	13.1
TkA07G247980	`PF12799`	LRR_4	151	167	0.14	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card