RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G189300
Reference: TK1151 Chr: Chr07 Coordinates: 48142479-48144972 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1011 bp · TkA07G189300|TK1151|cDNA

ATGATCGAGGAGTACTGTCCTCGCACGGAGCTTCAGAAGTTGGAGCATGAACTTTGGAACCTGGCAATGCAAGGTTCCGACATTACCAGTTACACCAACCGTTTCAACGAACTGGCAGCTTTGTGCCCAGGAATGGTCACCCCCGTGGCCAAAAAGATTGAACGCTATATCTGGGGCCTGTCATCCCAGATCCAAAACTCAGTCACGGCTTTCAACCCGTTGACATACGAAAGTGTCAAGAGCGTTGCTATACGCATGAC...

CDS

Download CDS FASTA

1011 bp · TkA07G189300|TK1151|CDS

ATGATCGAGGAGTACTGTCCTCGCACGGAGCTTCAGAAGTTGGAGCATGAACTTTGGAACCTGGCAATGCAAGGTTCCGACATTACCAGTTACACCAACCGTTTCAACGAACTGGCAGCTTTGTGCCCAGGAATGGTCACCCCCGTGGCCAAAAAGATTGAACGCTATATCTGGGGCCTGTCATCCCAGATCCAAAACTCAGTCACGGCTTTCAACCCGTTGACATACGAAAGTGTCAAGAGCGTTGCTATACGCATGAC...

Protein

Download Protein FASTA

336 aa · TkA07G189300|TK1151|PROTEIN

MIEEYCPRTELQKLEHELWNLAMQGSDITSYTNRFNELAALCPGMVTPVAKKIERYIWGLSSQIQNSVTAFNPLTYESVKSVAIRMTDQAVRNGTMVPKAEPSREQHKRKFWNNNNNNNNNNSNSSHNNNNNNRQVTSQAPPKRPHTNTAYAAIPVNAVAPQKQYAGNLPMCNKCNLHHTGACRGLVCSSCKKKGHTARYCRGTPVGPAPVVNTGADRACYGCGDTGHFKRNCPKAAGAAAGRVYALGAREAIADQRCVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G189300
TK1151 IDTkA07G189300
OH-1004 IDLXL04_023213
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)91.400
Protein coverage (%)TK1151 77.083 / OH-1004 22.762
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G189300
LocationChr07:48142479-48144972 (-)
DescriptionSimilar to pol: Retrovirus-related Pol polyprotein from transposon 17.6
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_023213 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006281 DNA repair Biological Process
GO:0006310 DNA recombination Biological Process
GO:0006313 DNA transposition Biological Process
GO:0006508 proteolysis Biological Process
GO:0015074 DNA integration Biological Process
GO:0075523 viral translational frameshifting Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0042575 DNA polymerase complex Cellular Component
GO:0003676 nucleic acid binding Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference
sce:YGR109W-B
sce:YIL082W-A
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.601
Rank 1 · TkA07G189300 · TK1151
Nucleus0.441
Rank 2 · TkA07G189300 · TK1151
Cell membrane0.063
Rank 3 · TkA07G189300 · TK1151
Endoplasmic reticulum0.054
Rank 4 · TkA07G189300 · TK1151
Mitochondrion0.044
Rank 5 · TkA07G189300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19259Ty3_capsid11-87 aa
PF08704GCD1463-151 aa
PF22575Vir1p112-139 aa
PF27939DUF8363166-183 aa
PF00098zf-CCHC172-176 aa
PF27939DUF8363186-239 aa
PF00098zf-CCHC187-201 aa
PF14392zf-CCHC_4187-202 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G189300PF19259Ty3_capsid11870.0003420.8
TkA07G189300PF08704GCD14631510.01116.1
TkA07G189300PF22575Vir1p1121396.15.1
TkA07G189300PF27939DUF83631661830.008516.6
TkA07G189300PF00098zf-CCHC1721760.0001822.2
TkA07G189300PF27939DUF83631862390.008516.6
TkA07G189300PF00098zf-CCHC1872010.0001822.2
TkA07G189300PF14392zf-CCHC_41872020.6910.3
TkA07G189300PF00098zf-CCHC2182350.0001822.2
TkA07G189300PF14392zf-CCHC_42182350.6910.3
TkA07G189300PF27939DUF83632782950.008516.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser