Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1566 bp · TkA07G186220|TK1151|cDNA
ATGCTTTACAATGATCTATATATCTCCATCACGAAGAATAGCTTTACAAGAAAAGCGTTGACGATGCATTCTTTTACGCTTGCAATAGTCGCAGTGCTTACCGGAATCTTGTTTGGGTTATGGTGGTCGGCTCATATCCGCCGTCAGAAACTTCCACCTGGCCCCATGCCGTTACCAATCATCGGAAGCCTCCACTTATTAGGAAAGCTCCCACACCGTGCCCTCCACAACCTCTCCCAAAAGTACGGTCCGATCATGTC...
1566 bp · TkA07G186220|TK1151|CDS
ATGCTTTACAATGATCTATATATCTCCATCACGAAGAATAGCTTTACAAGAAAAGCGTTGACGATGCATTCTTTTACGCTTGCAATAGTCGCAGTGCTTACCGGAATCTTGTTTGGGTTATGGTGGTCGGCTCATATCCGCCGTCAGAAACTTCCACCTGGCCCCATGCCGTTACCAATCATCGGAAGCCTCCACTTATTAGGAAAGCTCCCACACCGTGCCCTCCACAACCTCTCCCAAAAGTACGGTCCGATCATGTC...
Protein
Download Protein FASTA521 aa · TkA07G186220|TK1151|PROTEIN
MLYNDLYISITKNSFTRKALTMHSFTLAIVAVLTGILFGLWWSAHIRRQKLPPGPMPLPIIGSLHLLGKLPHRALHNLSQKYGPIMSIRLGTIQFVIVSSPEAAKLFLGTHDAVFSSRPNIEASKYFGYGRKGLTFTEYGSYWRSVRKFCTLELLSVTKINGFAGMRKEEIGLMVEEIRAASMAGKVVNLSEMVATLIEAMTCRMLFGKKNDESMVFKSIVDESMEAAGIFNLADYVPMLAPFDLQGLTKRFKSLSNKID...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G186220 |
|---|---|
| TK1151 ID | TkA07G186220 |
| OH-1004 ID | LXL04_002187 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 43.700 |
| Protein coverage (%) | TK1151 90.019 / OH-1004 91.732Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G186220 |
|---|---|
| Location | Chr07:47392951-47395701 (+) |
| Description | Similar to CYP92C6: Trimethyltridecatetraene synthase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009411 response to UV Biological Process GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process GO:0009733 response to auxin Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009835 fruit ripening Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0080027 response to herbivore Biological Process GO:0005576 extracellular region Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function |
| KEGG gene cross-reference | ath:AT5G07990 zma:100279968 zma:103631958 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067p45052-511 aaPF28715DUF8445246-336 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G186220 | PF00067 | p450 | 52 | 511 | 1e-100 | 338.5 |
| TkA07G186220 | PF28715 | DUF8445 | 246 | 336 | 0.27 | 11.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.