TkA07G178740 | RubberDandelionOmics

Gene overview

TkA07G178740

Reference: TK1151 Chr: Chr07 Coordinates: 45686500-45689477 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · TkA07G178740|TK1151|cDNA

TTTCACACGGATCACTGACTCACCCCCGTTTCCCTCTCTGTCTGTTTCCGTCGCCATCCCTCCTTCATCGACTCAAGGCCATACCTCCTGACCTCCATACCTCCACAGTCCAGACCATACCTCCATCAAATACTCGCCATCCCTTAATGCTCACACTCAATCGGCCTCCAATCGGTCCAAGAAATCGGTACTCGAACTAGGGTTTTGGTGGCTTGTGCTCACTGTGAATAAGGTCGAAGTTCAAGGGTTTGGGGGTTTCG...

CDS

Download CDS FASTA

1332 bp · TkA07G178740|TK1151|CDS

ATGTTTCTGCATAATCGATCAATTTCTTCCAATATTAGTTATTATGAGGTAAGATTCGGTAACAATTTTATGGCAATATTAACAATAAGTCTAGCAAGTTCAGGAATCGTCACTTTTCCTATCGGCGTCCTTCACCATCACAGCCACGCCTCCATGATTTTGACGATTTGTGTTTCAAGGACGGCTCTTAATCTCCTTCGCAGATCCGGATCCTCCCTACCCTCTTTCCCTATCTGGCCTGAAATGGATTTGTATGAACT...

Protein

Download Protein FASTA

443 aa · TkA07G178740|TK1151|PROTEIN

MFLHNRSISSNISYYEVRFGNNFMAILTISLASSGIVTFPIGVLHHHSHASMILTICVSRTALNLLRRSGSSLPSFPIWPEMDLYELRGNQYGPTEGRLVLRGQRLVLEADSTIQTIMEKLESYKTRVALNFEGFQYQLGDFQLRVGKVVSTQSESLRGIVMESHYPLGPVWSATGAPTSAPPKTTSKPTAPAPPPPPPPPPLASLFTSEPPQPSLSRPKEGMAAVIQEIGSKPVTAGLRKVTDDMKTKNRADRVGFVSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G178740`
TK1151 ID	TkA07G178740
OH-1004 ID	LXL04_038270
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.500
Protein coverage (%)	TK1151 63.431 / OH-1004 53.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G178740

Location Chr07:45686500-45689477 (-)

Description Similar to CAP1: Cyclase-associated protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34490`	Actin monomer binding protein that accelerates the exchange of ADP for ATP.	Arabidopsis CAP regulates the actin cytoskeleton necessary for plant cell elongation and division.2002 · DOI: 10.1105/tpc.010301 Identification of Arabidopsis cyclase-associated protein 1 as the first nucleotide exchange factor for plant actin.2007 · DOI: 10.1091/mbc.e06-11-1041 Arabidopsis CAP1 - a key regulator of actin organisation and development.2007 · DOI: 10.1242/jcs.007302

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038270 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0007165 signal transduction Biological Process

GO:0007190 activation of adenylate cyclase activity Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0099140 presynaptic actin cytoskeleton organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G34490

bta:504519

hsa:10487

rno:116653

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA07G178740 · TK1151

Nucleus0.305

Rank 2 · TkA07G178740 · TK1151

Endoplasmic reticulum0.111

Rank 3 · TkA07G178740 · TK1151

Cell membrane0.088

Rank 4 · TkA07G178740 · TK1151

Golgi apparatus0.084

Rank 5 · TkA07G178740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22812CR_prot_dom_plant18-32 aa

PF08612Med2044-233 aa

PF05308Mito_fiss_reg177-229 aa

PF22812CR_prot_dom_plant189-218 aa

PF08603CAP_C278-440 aa

PF19860DUF6334281-324 aa

PF23248KH_PARP14_2291-330 aa

PF20234DUF6591330-374 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G178740	`PF22812`	CR_prot_dom_plant	18	32	1.7	9.9
TkA07G178740	`PF08612`	Med20	44	233	4.3e-16	59.7
TkA07G178740	`PF05308`	Mito_fiss_reg	177	229	0.033	15.0
TkA07G178740	`PF22812`	CR_prot_dom_plant	189	218	1.7	9.9
TkA07G178740	`PF08603`	CAP_C	278	440	1.4e-53	181.5
TkA07G178740	`PF19860`	DUF6334	281	324	0.11	13.3
TkA07G178740	`PF23248`	KH_PARP14_2	291	330	0.29	11.7
TkA07G178740	`PF20234`	DUF6591	330	374	0.36	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65902`	Arabidopsis thaliana	sp\|O65902\|ACAP1_ARATH Cyclase-associated protein 1	68.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card