RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G174880
Reference: TK1151 Chr: Chr07 Coordinates: 44805583-44806961 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

763 bp · TkA07G174880|TK1151|cDNA

ATCACCCCTTGTAACCGTATAAAATAAGAAAGAGCACCGAATCGCCCATCCATATCTTCATTTTTTGCAAAATTGACTTTGCATCCTCTCCAAGGGTTTTCATCGTCTCCAAAAAGTTCGACCTAAATTCCGTCCGACCAAACCACCATGTCGTCGTCGTCGAAGATGATCGTTCTGAAGAGCTCTGACGGAGAAACCTTCGAGGTAGAAGAGGCAGTGGCGTTGGAGTCACAAACGATCAAACATATGATCGAAGATGA...

CDS

Download CDS FASTA

471 bp · TkA07G174880|TK1151|CDS

ATGTCGTCGTCGTCGAAGATGATCGTTCTGAAGAGCTCTGACGGAGAAACCTTCGAGGTAGAAGAGGCAGTGGCGTTGGAGTCACAAACGATCAAACATATGATCGAAGATGACTGCGCCGACACCAGCATCCCGCTCCCTAACGTCACAAGCAAGATCCTCTCGAAGGTTATCGAGTACTGCAAGAAGCATGTGGAGACACCCAAGACCGATGATAAGACAGCTGAGGAGGATCTGAAATCGTTCGATTCCGAGTTTGT...

Protein

Download Protein FASTA

156 aa · TkA07G174880|TK1151|PROTEIN

MSSSSKMIVLKSSDGETFEVEEAVALESQTIKHMIEDDCADTSIPLPNVTSKILSKVIEYCKKHVETPKTDDKTAEEDLKSFDSEFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G174880
TK1151 IDTkA07G174880
OH-1004 IDLXL04_019626
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 98.718 / OH-1004 99.355
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G174880
LocationChr07:44805583-44806961 (-)
DescriptionSimilar to SKP1B: SKP1-like protein 1B
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g42190 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. No verified direct reference in this release
At1g75950 Involved in ubiquitination and subsequent proteasomal degradation of target proteins.
The Arabidopsis SKP1-LIKE1 gene is essential for male meiosis and may control homologue separation.1999 · DOI: 10.1073/pnas.96.20.11416
The ASK1 gene regulates development and interacts with the UFO gene to control floral organ identity in Arabidopsis.1999 · DOI: 10.1002/(sici)1520-6408(1999)25:3<209::aid-dvg4>3.0.co;2-o
The ASK1 gene regulates B function gene expression in cooperation with UFO and LEAFY in Arabidopsis.2001 · DOI: 10.1242/dev.128.14.2735
Members of the Arabidopsis-SKP1-like gene family exhibit a variety of expression patterns and may play diverse roles in Arabidopsis.2003 · DOI: 10.1104/pp.103.024703
The ASK1 and ASK2 genes are essential for Arabidopsis early development.2004 · DOI: 10.1105/tpc.017772
At1g20140 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0456300 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. No verified direct reference in this release
Os09g0539500 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019626 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000226 microtubule cytoskeleton organization Biological Process
GO:0000278 mitotic cell cycle Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0007059 chromosome segregation Biological Process
GO:0007140 male meiotic nuclear division Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0016567 protein ubiquitination Biological Process
KEGG gene cross-reference
ath:AT1G20140
ath:AT1G75950
ath:AT4G34210
ath:AT5G42190
dosa:Os09g0539500
osa:4347721
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.685
Rank 1 · TkA07G174880 · TK1151
Nucleus0.438
Rank 2 · TkA07G174880 · TK1151
Mitochondrion0.082
Rank 3 · TkA07G174880 · TK1151
Cell membrane0.076
Rank 4 · TkA07G174880 · TK1151
Endoplasmic reticulum0.043
Rank 5 · TkA07G174880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03931Skp1_POZ6-65 aa
PF00651BTB9-81 aa
PF01466Skp116-29 aa
PF01466Skp172-76 aa
PF00249Myb_DNA-binding74-80 aa
PF03931Skp1_POZ79-90 aa
PF01466Skp1107-154 aa
PF03931Skp1_POZ115-123 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G174880PF03931Skp1_POZ6651.4e-31109.1
TkA07G174880PF00651BTB9810.0116.7
TkA07G174880PF01466Skp116292.1e-31108.2
TkA07G174880PF01466Skp172762.1e-31108.2
TkA07G174880PF00249Myb_DNA-binding74801.59.7
TkA07G174880PF03931Skp1_POZ79901.4e-31109.1
TkA07G174880PF01466Skp11071542.1e-31108.2
TkA07G174880PF03931Skp1_POZ1151231.4e-31109.1
TkA07G174880PF00249Myb_DNA-binding1161311.59.7
TkA07G174880PF00249Myb_DNA-binding1361471.59.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FHW7Arabidopsis thalianasp|Q9FHW7|SKP1B_ARATH SKP1-like protein 1B76.600%Swiss-ProtHigh
Q39255Arabidopsis thalianasp|Q39255|SKP1A_ARATH SKP1-like protein 1A76.100%Swiss-ProtHigh
Q9LNT9Arabidopsis thalianasp|Q9LNT9|ASK4_ARATH SKP1-like protein 471.800%Swiss-ProtHigh
Q6PL11Oryza sativa subsp. japonicasp|Q6PL11|SKP1_ORYSJ SKP1-like protein 174.700%Swiss-ProtHigh
Q651E8Oryza sativa subsp. japonicasp|Q651E8|SKP20_ORYSJ SKP1-like protein 2072.900%Swiss-ProtHigh

JBrowse

View in Genome Browser