Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1724 bp · TkA07G162200|TK1151|cDNA
TGATATTTTATCGAGTTGTGTCTGTATTTCTTCATATCCTTGTAAAGATTTTCTGAACTCAATTCATGAATCTGTAATCTCATCAAGTGTTTGTTGAAGTGCATTTATAGATCAGATGTCTGCTTTTACCCTTTCATCGAATACCAACCTTAAGTCTTAAAATCACATCAAGACTACATAAATCCTCTGCCTTTGTGATAATCGACGCAATTTCAATCTTCAGCTCAGATCTCCTGTTTTGCTCATTAGTAGTAATTCCC...
849 bp · TkA07G162200|TK1151|CDS
ATGACGAAAACACCCTCGAGGGCCCAAGCGTCCCTTCCAACAGTGATAGCAAAGGAACCGATCAAAACATCCCAAACGTTTCTTCCTCTGACTACACCTCAGAAGAAGACGACAAAAAACGCCCCCGATTCCCAAAAACAAATGGTTCTTTACAATCCTCCAGATGGAATCACAATCACAGCCGTCCAAAATAAACCCCAATCGTTATCCAAAAAACTTTTAGATACTCGAAGAGTTTCGAATATCCCGGAAGTAGGTGC...
Protein
Download Protein FASTA282 aa · TkA07G162200|TK1151|PROTEIN
MTKTPSRAQASLPTVIAKEPIKTSQTFLPLTTPQKKTTKNAPDSQKQMVLYNPPDGITITAVQNKPQSLSKKLLDTRRVSNIPEVGAFTVQCANCFKWRLIPDQEKYEVIREHITDQPFLCATTRQWDRDVSCDDPTDIEQDGTRIWAIDKPNIAKPPPGWKRLLRLRSEGSSKFADVYYTSPTGSKLRSMPEVQKYLANHPEHAQGVGISRFSFQIPRPLRDDYVRKRPSQMPEPAPVQPIAWAHPEEKLNLHLAEPLA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G162200 |
|---|---|
| TK1151 ID | TkA07G162200 |
| OH-1004 ID | LXL04_003066 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 57.100 |
| Protein coverage (%) | TK1151 77.305 / OH-1004 72.924Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G162200 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:41696539-41702001 (-) | |||||||||
| Description | No functional description available | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0000118 histone deacetylase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0009507 chloroplast Cellular Component GO:0016581 NuRD complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0008327 methyl-CpG binding Molecular Function GO:0019899 enzyme binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G63030 ath:AT4G00416 ath:AT4G22745 ath:AT5G35330 ath:AT5G35338 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF15368BioT22-59 aaPF22970DUF702841-59 aaPF07496zf-CW89-138 aaPF01429MBD158-216 aaPF22970DUF7028173-200 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G162200 | PF15368 | BioT2 | 2 | 59 | 0.27 | 11.8 |
| TkA07G162200 | PF22970 | DUF7028 | 41 | 59 | 0.17 | 12.6 |
| TkA07G162200 | PF07496 | zf-CW | 89 | 138 | 1.9e-10 | 41.3 |
| TkA07G162200 | PF01429 | MBD | 158 | 216 | 5.6e-15 | 55.4 |
| TkA07G162200 | PF22970 | DUF7028 | 173 | 200 | 0.17 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.