TkA07G157530 | RubberDandelionOmics

Gene overview

TkA07G157530

Reference: TK1151 Chr: Chr07 Coordinates: 40562186-40564540 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · TkA07G157530|TK1151|cDNA

ATGCCTCCGCCGCGCTTATGCTCCCTACTCCTCCTCTCCCTCATTTCCACCGCCACCCTTCAGATCTGCTCCGCGGCCGGAGACGACAGCGATGTAGACACACTTGTTTTCGAGAACCCAAGGCTCCGGCAAGCCTATATTGCTCTCCAAGCATGGAAACAAGCCATATTTTCTGACCCCTTCAACTTCACTGCCAACTGGAATGGCTCTAACGTCTGCTCCTACGGCGGTGTCTATTGTGCTCCTTCCCCAGCAAACCC...

CDS

Download CDS FASTA

2034 bp · TkA07G157530|TK1151|CDS

ATGCCTCCGCCGCGCTTATGCTCCCTACTCCTCCTCTCCCTCATTTCCACCGCCACCCTTCAGATCTGCTCCGCGGCCGGAGACGACAGCGATGTAGACACACTTGTTTTCGAGAACCCAAGGCTCCGGCAAGCCTATATTGCTCTCCAAGCATGGAAACAAGCCATATTTTCTGACCCCTTCAACTTCACTGCCAACTGGAATGGCTCTAACGTCTGCTCCTACGGCGGTGTCTATTGTGCTCCTTCCCCAGCAAACCC...

Protein

Download Protein FASTA

677 aa · TkA07G157530|TK1151|PROTEIN

MPPPRLCSLLLLSLISTATLQICSAAGDDSDVDTLVFENPRLRQAYIALQAWKQAIFSDPFNFTANWNGSNVCSYGGVYCAPSPANPSIRVVAGIDLNHADIAGFLPPELGLLTDLALFHINSNRFCGTVPTSFKNLTLLHELDLSNNRFVGVFPTVVLSLPALKYLDLRFNEFEGSVPMTLFDKDLDAVFLNDNRFQFGIPPNLGNSPVSVLVLANNNLGGCIPASIGQMGRTLNEIILMNDNLTGCLPVQIGMLKEVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G157530`
TK1151 ID	TkA07G157530
OH-1004 ID	LXL04_028457
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 49.040 / OH-1004 98.516 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G157530

Location Chr07:40562186-40564540 (-)

Description Similar to LRX2: Leucine-rich repeat extensin-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62440`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	Synergistic interaction of the two paralogous Arabidopsis genes LRX1 and LRX2 in cell wall formation during root hair development.2003 · DOI: 10.1046/j.1365-313x.2003.01784.x
`At1g12040`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	The chimeric leucine-rich repeat/extensin cell wall protein LRX1 is required for root hair morphogenesis in Arabidopsis thaliana.2001 · DOI: 10.1101/gad.200201 Synergistic interaction of the two paralogous Arabidopsis genes LRX1 and LRX2 in cell wall formation during root hair development.2003 · DOI: 10.1046/j.1365-313x.2003.01784.x
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At3g22800`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028457 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

GO:0042277 peptide binding Molecular Function

KEGG gene cross-reference

ath:AT1G12040

ath:AT1G62440

ath:AT3G24480

ath:AT4G13340

ath:AT4G18670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.490

Rank 1 · TkA07G157530 · TK1151

Extracellular0.285

Rank 2 · TkA07G157530 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA07G157530 · TK1151

Cytoplasm0.100

Rank 4 · TkA07G157530 · TK1151

Nucleus0.049

Rank 5 · TkA07G157530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_248-80 aa

PF00560LRR_195-111 aa

PF23598LRR_1496-175 aa

PF12799LRR_498-124 aa

PF23211LRR_LRWD1105-157 aa

PF13855LRR_8116-173 aa

PF00560LRR_1119-137 aa

PF23211LRR_LRWD1134-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G157530	`PF08263`	LRRNT_2	48	80	7.3e-05	23.7
TkA07G157530	`PF00560`	LRR_1	95	111	5.7e-16	55.9
TkA07G157530	`PF23598`	LRR_14	96	175	6.2e-07	29.2
TkA07G157530	`PF12799`	LRR_4	98	124	2.8e-06	28.1
TkA07G157530	`PF23211`	LRR_LRWD1	105	157	0.051	14.0
TkA07G157530	`PF13855`	LRR_8	116	173	3.2e-19	69.2
TkA07G157530	`PF00560`	LRR_1	119	137	5.7e-16	55.9
TkA07G157530	`PF23211`	LRR_LRWD1	134	174	0.051	14.0
TkA07G157530	`PF13516`	LRR_6	138	149	0.00044	20.8
TkA07G157530	`PF00560`	LRR_1	140	157	5.7e-16	55.9
TkA07G157530	`PF12799`	LRR_4	140	172	2.8e-06	28.1
TkA07G157530	`PF00560`	LRR_1	164	182	5.7e-16	55.9
TkA07G157530	`PF13516`	LRR_6	164	175	0.00044	20.8
TkA07G157530	`PF00560`	LRR_1	190	207	5.7e-16	55.9
TkA07G157530	`PF12799`	LRR_4	192	219	2.8e-06	28.1
TkA07G157530	`PF23211`	LRR_LRWD1	192	223	0.051	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48809`	Arabidopsis thaliana	sp\|O48809\|LRX2_ARATH Leucine-rich repeat extensin-like protein 2	72.300%	Swiss-Prot	Medium
`O65375`	Arabidopsis thaliana	sp\|O65375\|LRX1_ARATH Leucine-rich repeat extensin-like protein 1	66.000%	Swiss-Prot	Medium
`Q9T0K5`	Arabidopsis thaliana	sp\|Q9T0K5\|LRX3_ARATH Leucine-rich repeat extensin-like protein 3	77.600%	Swiss-Prot	Low
`Q9LUI1`	Arabidopsis thaliana	sp\|Q9LUI1\|LRX6_ARATH Leucine-rich repeat extensin-like protein 6	67.900%	Swiss-Prot	Low
`Q9LHF1`	Arabidopsis thaliana	sp\|Q9LHF1\|LRX4_ARATH Leucine-rich repeat extensin-like protein 4	69.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card