RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G157450
Reference: TK1151 Chr: Chr07 Coordinates: 40528910-40532250 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2271 bp · TkA07G157450|TK1151|cDNA

ATGGCAACCGAAAGTCCGATCCGAATCATTGAAGCAAATAGAAAATGGAATGATATAAACATGGGAATTGAGGAGATGGGATTGGGCTTAAATTCCCAAAGATTCCATAATCCAACTCCTAATCGAAGTGGAAGTGCACCTCCAAGTATCGAAGGTTCATTTGCCGCCATTGAAAACCTCATGTTTAGGCAACACTTTGCCAGAGATGTTCCTAATGTTCCCGAGTCTGAAGAACAACTTAGAGCCGATCCATCTTATTT...

CDS

Download CDS FASTA

2271 bp · TkA07G157450|TK1151|CDS

ATGGCAACCGAAAGTCCGATCCGAATCATTGAAGCAAATAGAAAATGGAATGATATAAACATGGGAATTGAGGAGATGGGATTGGGCTTAAATTCCCAAAGATTCCATAATCCAACTCCTAATCGAAGTGGAAGTGCACCTCCAAGTATCGAAGGTTCATTTGCCGCCATTGAAAACCTCATGTTTAGGCAACACTTTGCCAGAGATGTTCCTAATGTTCCCGAGTCTGAAGAACAACTTAGAGCCGATCCATCTTATTT...

Protein

Download Protein FASTA

756 aa · TkA07G157450|TK1151|PROTEIN

MATESPIRIIEANRKWNDINMGIEEMGLGLNSQRFHNPTPNRSGSAPPSIEGSFAAIENLMFRQHFARDVPNVPESEEQLRADPSYFAYYWAHVNLNPRLPPPLISGENRNHFRNVRNTGNSNKRLTSFDDSFSGSLQLDHSSLSTHKEESDDEISPKKEDLPLIPEPKEEKENQKDSNNPTTTTVSSSETDVSTLRNRIASLNIPNIPKIESERNQEDSSTYQQQRNMLHIHGTHPQIVSLPQTSYVMNQNYMSEVRST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G157450
TK1151 IDTkA07G157450
OH-1004 IDLXL04_028452
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G157450
LocationChr07:40528910-40532250 (+)
DescriptionSimilar to APUM5: Pumilio homolog 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g25880 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At3g20250 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At3g10360 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At2g29190 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release
At2g29200 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028452 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006417 regulation of translation Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009819 drought recovery Biological Process
GO:0010608 post-transcriptional regulation of gene expression Biological Process
GO:0051607 defense response to virus Biological Process
GO:0061158 3'-UTR-mediated mRNA destabilization Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference
ath:AT2G29190
ath:AT4G25880
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.773
Rank 1 · TkA07G157450 · TK1151
Nucleus0.249
Rank 2 · TkA07G157450 · TK1151
Cell membrane0.073
Rank 3 · TkA07G157450 · TK1151
Lysosome / Vacuole0.048
Rank 4 · TkA07G157450 · TK1151
Golgi apparatus0.042
Rank 5 · TkA07G157450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10918DUF2718144-229 aa
PF22493PUF_NOP9425-477 aa
PF00806PUF432-465 aa
PF00806PUF470-496 aa
PF21956DUF6922478-496 aa
PF22493PUF_NOP9491-536 aa
PF00806PUF503-536 aa
PF22493PUF_NOP9503-559 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G157450PF10918DUF27181442290.009817.1
TkA07G157450PF22493PUF_NOP94254772e-2177.3
TkA07G157450PF00806PUF4324652e-82270.7
TkA07G157450PF00806PUF4704962e-82270.7
TkA07G157450PF21956DUF69224784960.01615.4
TkA07G157450PF22493PUF_NOP94915362e-2177.3
TkA07G157450PF00806PUF5035362e-82270.7
TkA07G157450PF22493PUF_NOP95035592e-2177.3
TkA07G157450PF00806PUF5395612e-82270.7
TkA07G157450PF22493PUF_NOP95396202e-2177.3
TkA07G157450PF08144CPL5585580.03315.2
TkA07G157450PF00806PUF5766102e-82270.7
TkA07G157450PF21956DUF69225885980.01615.4
TkA07G157450PF00806PUF6136452e-82270.7
TkA07G157450PF22493PUF_NOP96176802e-2177.3
TkA07G157450PF21956DUF69226236420.01615.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C5E7Arabidopsis thalianasp|Q9C5E7|PUM6_ARATH Pumilio homolog 6, chloroplastic42.900%Swiss-ProtMedium
Q9LJX4Arabidopsis thalianasp|Q9LJX4|PUM5_ARATH Pumilio homolog 540.100%Swiss-ProtMedium
Q9SS47Arabidopsis thalianasp|Q9SS47|PUM4_ARATH Pumilio homolog 464.000%Swiss-ProtLow
Q9ZW06Arabidopsis thalianasp|Q9ZW06|PUM2_ARATH Pumilio homolog 263.700%Swiss-ProtLow
Q9ZW07Arabidopsis thalianasp|Q9ZW07|PUM1_ARATH Pumilio homolog 163.600%Swiss-ProtLow

JBrowse

View in Genome Browser