TkA07G157440 | RubberDandelionOmics

Gene overview

TkA07G157440

Reference: TK1151 Chr: Chr07 Coordinates: 40523419-40525383 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA07G157440|TK1151|cDNA

CAAAGACCGAAATTGGTGAGCGGGGCGCTTTCTCCCTCGTGCGATCAACTCCAAAAGAAACAAAGCACACTAACCCTAACTCATTCATCCGGCCGCCGTTCACTTCCAGGTCGTCGACCACCTCAAGAACAGCCACGCTCGTTGTTTCCGGCTTGAACCAAATGCCGCCATCGGAGCCGCACTTGTAGGTCGCCGTCAGGAATGAGCTCGGAAGAAGCATCACCATCTTCATCTCCGTCTTATTCAGCCACCACCGCTGG...

CDS

Download CDS FASTA

933 bp · TkA07G157440|TK1151|CDS

ATGATACTCGTTCTAGTTTGCCAAAAGCTATATAAGATGGTTGCCAAGAATGGACGTGGCCAAGTCTTGAGATGGCGTGAAATAGAAGATCTGTTTGCAGAAAAAAGTGGTAAACGATGGCCATTCAAATCATTAAAAAACAAATATGATGCAATGAAAAAGGATTGGCGTCTATGGAAATTCCTAAAAACGGGAGAAACCGGTTTAGGTTGGAACTCTACTACAGGAAAACTTTATTGTTCAGATGAGTGGTGGGACCA...

Protein

Download Protein FASTA

310 aa · TkA07G157440|TK1151|PROTEIN

MILVLVCQKLYKMVAKNGRGQVLRWREIEDLFAEKSGKRWPFKSLKNKYDAMKKDWRLWKFLKTGETGLGWNSTTGKLYCSDEWWDQKLKEKPDAKKFRNKGVLPIVEEKWDHLFGDAVATGEACVAPSLDPNHIPISVTEDEEIQNTEDGADGVYREYNEYYNRMGSLDNIDGPSWRNLVQEVQNNPPNTDPATTNITKSKGDKRKRRQSAGSVYLRQHLQKVDEMHYDIVDAIKGNTTKKADLETSVDQVMDIMNRIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G157440`
TK1151 ID	TkA07G157440
OH-1004 ID	LXL04_028451
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.800
Protein coverage (%)	TK1151 88.065 / OH-1004 48.319 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G157440

Location Chr07:40523419-40525383 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05800`	Transcriptional repressor that associates with ribosomal protein promoters.	NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028451 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source) No functional description available

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA07G157440 · TK1151

Cytoplasm0.095

Rank 2 · TkA07G157440 · TK1151

Cell membrane0.019

Rank 3 · TkA07G157440 · TK1151

Mitochondrion0.014

Rank 4 · TkA07G157440 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA07G157440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776Myb_DNA-bind_324-87 aa

PF12776Myb_DNA-bind_3156-180 aa

PF25712crAss_CARGO2170-254 aa

PF12776Myb_DNA-bind_3200-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G157440	`PF12776`	Myb_DNA-bind_3	24	87	4.8e-09	37.8
TkA07G157440	`PF12776`	Myb_DNA-bind_3	156	180	4.8e-09	37.8
TkA07G157440	`PF25712`	crAss_CARGO2	170	254	0.011	15.4
TkA07G157440	`PF12776`	Myb_DNA-bind_3	200	200	4.8e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFJ8`	Arabidopsis thaliana	sp\|Q9FFJ8\|LIMYB_ARATH L10-interacting MYB domain-containing protein	32.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card