TkA07G154630 | RubberDandelionOmics

Gene overview

TkA07G154630

Reference: TK1151 Chr: Chr07 Coordinates: 39803191-39810753 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1335 bp · TkA07G154630|TK1151|cDNA

AATTGGACTTTAAAAATGAACTCTCAGAAGTGAAATCCCCCGTCAAACACCTTCTCACACAATCGCACCACCTGAGCGAAGCCCTAAGTAAAACCCTAAATCTCCACTCGGAAACCTATCGGCACATCTTCATCTACGATCTCATAAATCGGATTTTTGATGCTGCTTACTCATACCTTGTGTCCTATGTTAAAAAATTAAAGTTCGGAGCCCTCGTAAGGTTGATACGGCAAGGTCACCAGGATGTTCAATCAGTGCTG...

CDS

Download CDS FASTA

537 bp · TkA07G154630|TK1151|CDS

ATGAAAGGTGTCAAATATTTGGATTGCTATGGAGTTGACAATGCTTTGGTGCGTGTTGGTGATCCTACTTTCTTGGGCTATTTCATTGACAATGGTGTAACTCCCGCTGTTAAAGTTGTGCGCAAGGCATACCCTCAAGAGAAAGTTGGTGTATTTGTACGGCGTGGTAAAGGAGGGCCTGTAACTGTAGTTGAATACATTGAGTTGGATCAGTCACTCGCTAGTGAAATTAATCAAGGAATTGGCCGACTCAGATATTG...

Protein

Download Protein FASTA

178 aa · TkA07G154630|TK1151|PROTEIN

MKGVKYLDCYGVDNALVRVGDPTFLGYFIDNGVTPAVKVVRKAYPQEKVGVFVRRGKGGPVTVVEYIELDQSLASEINQGIGRLRYCWSNEAYEEAIVAKYGDDTSCYPLLDSQIWLEVSGGKKKGRVFGFGSISDPESFLTGTSSTATSREKKAAEMDAKAAEMDVKHHKMCEELDA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G154630`
TK1151 ID	TkA07G154630
OH-1004 ID	LXL04_014256
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 50.562 / OH-1004 18.293 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G154630

Location Chr07:39803191-39810753 (+)

Description Similar to GLCNAC1PUT1: UDP-N-acetylglucosamine diphosphorylase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31070`	Uridylyltransferase involved in the biosynthesis of UDP-glucosamine, an essential precursor for glycoprotein and glycolipid synthesis.	No verified direct reference in this release
`At2g35020`	Uridylyltransferase involved in the biosynthesis of UDP-glucosamine, an essential precursor for glycoprotein and glycolipid synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014256 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006011 UDP-alpha-D-glucose metabolic process Biological Process

GO:0006047 UDP-N-acetylglucosamine metabolic process Biological Process

GO:0006048 UDP-N-acetylglucosamine biosynthetic process Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019276 UDP-N-acetylgalactosamine metabolic process Biological Process

GO:0032481 positive regulation of type I interferon production Biological Process

GO:0140374 antiviral innate immune response Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G31070

ath:AT2G35020

dre:393264

hsa:6675

mmu:107652

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.784

Rank 1 · TkA07G154630 · TK1151

Cytoplasm0.291

Rank 2 · TkA07G154630 · TK1151

Cell membrane0.024

Rank 3 · TkA07G154630 · TK1151

Mitochondrion0.023

Rank 4 · TkA07G154630 · TK1151

Extracellular0.020

Rank 5 · TkA07G154630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01704UDPGP2-71 aa

PF03004Transposase_24106-137 aa

PF03004Transposase_24148-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G154630	`PF01704`	UDPGP	2	71	0.00024	20.7
TkA07G154630	`PF03004`	Transposase_24	106	137	0.0017	19.2
TkA07G154630	`PF03004`	Transposase_24	148	158	0.0017	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940S3`	Arabidopsis thaliana	sp\|Q940S3\|UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1	79.800%	Swiss-Prot	Medium
`O64765`	Arabidopsis thaliana	sp\|O64765\|UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2	78.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card