RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G147820
Reference: TK1151 Chr: Chr07 Coordinates: 38131913-38143483 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4797 bp · TkA07G147820|TK1151|cDNA

TTTACACCCTATCTCCCTCCATAGCCTCTCTAAACCCTTCCCAGCTTCCCTCGCTCCACTTCACTTAGACTAGGTTTTCAACACAAACCCTCCGTGGCTTCACCACGATCGATGGCAGCTCGGTCGTCTTTGGCCGGTATGGAGGTTCCGATTATCGGCAGCGATTCTACTAAATGGTTTAACGTCGCTGTACCTTCAACCTGTACTTCTATGCCGCCGCCTGAGCCCTTTGCTCCTCCTACTGACGACGCATCATCATG...

CDS

Download CDS FASTA

4488 bp · TkA07G147820|TK1151|CDS

ATGGCAGCTCGGTCGTCTTTGGCCGGTATGGAGGTTCCGATTATCGGCAGCGATTCTACTAAATGGTTTAACGTCGCTGTACCTTCAACCTGTACTTCTATGCCGCCGCCTGAGCCCTTTGCTCCTCCTACTGACGACGCATCATCATGCTGCAACATTGGCTACCCTCCTACTTATTTCATTTGGAGAATAGACAAGAGTTGTCCAAATATTCTGGAGATAGTCGAATTCCACAGTTTTGAGGAATTTTCAAGGGTTGG...

Protein

Download Protein FASTA

1495 aa · TkA07G147820|TK1151|PROTEIN

MAARSSLAGMEVPIIGSDSTKWFNVAVPSTCTSMPPPEPFAPPTDDASSCCNIGYPPTYFIWRIDKSCPNILEIVEFHSFEEFSRVGLRIEFTSALCPFALICKNEVSSSPVNPYILYALTVTGVAYLIRLNNITSYASCTVFPPSDVAELAIQNYGDYGAITAMSATAGCLVIGGRTGLVGCFRLGILDPSDPGFLHELRDDSSLGRLWSKFSRRTIAPVKCLVCLEIQGKRLLLVLHSDGLLQVWDLLSFSRLLSYTI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G147820
TK1151 IDTkA07G147820
OH-1004 IDLXL04_028371
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.400
Protein coverage (%)TK1151 99.666 / OH-1004 97.513
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G147820
LocationChr07:38131913-38143483 (+)
DescriptionSimilar to NUP160: Nuclear pore complex protein NUP160
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g33410 Contributes to the transfer of mature mRNA from the nucleus to the cytosol.
A putative Arabidopsis nucleoporin, AtNUP160, is critical for RNA export and required for plant tolerance to cold stress.2006 · DOI: 10.1128/mcb.01063-06
A loss-of-function mutation in the nucleoporin AtNUP160 indicates that normal auxin signalling is required for a proper ethylene response in Arabidopsis.2012 · DOI: 10.1093/jxb/err424
Putative members of the Arabidopsis Nup107-160 nuclear pore sub-complex contribute to pathogen defense.2012 · DOI: 10.1111/j.1365-313x.2012.04928.x
Nucleoporins Nup160 and Seh1 are required for disease resistance in Arabidopsis.2012 · DOI: 10.4161/psb.21426

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028371 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006406 mRNA export from nucleus Biological Process
GO:0006606 protein import into nucleus Biological Process
GO:0006913 nucleocytoplasmic transport Biological Process
GO:0006952 defense response Biological Process
GO:0006974 DNA damage response Biological Process
GO:0009409 response to cold Biological Process
GO:0009733 response to auxin Biological Process
GO:0015031 protein transport Biological Process
GO:0016973 poly(A)+ mRNA export from nucleus Biological Process
GO:0032502 developmental process Biological Process
GO:0046822 regulation of nucleocytoplasmic transport Biological Process
GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process
KEGG gene cross-reference
ath:AT1G33410
dme:Dmel_CG4738
hsa:23279
mmu:59015
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.743
Rank 1 · TkA07G147820 · TK1151
Cytoplasm0.238
Rank 2 · TkA07G147820 · TK1151
Cell membrane0.056
Rank 3 · TkA07G147820 · TK1151
Golgi apparatus0.043
Rank 4 · TkA07G147820 · TK1151
Lysosome / Vacuole0.041
Rank 5 · TkA07G147820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11715Beta-prop_Nup120_16059-524 aa
PF12895ANAPC3374-401 aa
PF17238NUP160_helical_2544-732 aa
PF23300HEAT_Nup120633-707 aa
PF23345NUP160_helical680-775 aa
PF12895ANAPC3849-872 aa
PF23300HEAT_Nup120855-874 aa
PF23347TPR_Nup160_C858-882 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G147820PF11715Beta-prop_Nup120_160595241.5e-42146.6
TkA07G147820PF12895ANAPC33744010.1713.0
TkA07G147820PF17238NUP160_helical_25447321e-74251.4
TkA07G147820PF23300HEAT_Nup1206337072.8e-1247.5
TkA07G147820PF23345NUP160_helical6807750.001518.6
TkA07G147820PF12895ANAPC38498720.1713.0
TkA07G147820PF23300HEAT_Nup1208558742.8e-1247.5
TkA07G147820PF23347TPR_Nup160_C8588822.3e-1350.7
TkA07G147820PF23300HEAT_Nup12091610662.8e-1247.5
TkA07G147820PF23354TPR_NUP160_120_M91811676.1e-35121.6
TkA07G147820PF12895ANAPC3103410440.1713.0
TkA07G147820PF23347TPR_Nup160_C121814892.3e-1350.7
TkA07G147820PF23300HEAT_Nup120139514152.8e-1247.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C811Arabidopsis thalianasp|Q9C811|NU160_ARATH Nuclear pore complex protein NUP16046.500%Swiss-ProtMedium

JBrowse

View in Genome Browser