TkA07G146900 | RubberDandelionOmics

Gene overview

TkA07G146900

Reference: TK1151 Chr: Chr07 Coordinates: 37943935-37945082 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · TkA07G146900|TK1151|cDNA

CATTGAAACACAAGCAATCCATCTTATAACATGGACAATGGTGTAGAAGTTTCGGGTGCAACCCACAGGTTGGCTGGTAAGGTAGCACTTGTTACAGGTGGAGCTCGAGGAATTGGAGAGTCCATTGCTAAGTTGTTCACTAAACATGGAGCCAAAGTCATAATCGTAGACATCCTGGATGATTTAGGTCATGCTGTTTGTGAAAAAATCGGTCTTGGAATGGCTTCTTTCATCCACTGCGATGTGTGCGTAGAATCCGA...

CDS

Download CDS FASTA

822 bp · TkA07G146900|TK1151|CDS

ATGGACAATGGTGTAGAAGTTTCGGGTGCAACCCACAGGTTGGCTGGTAAGGTAGCACTTGTTACAGGTGGAGCTCGAGGAATTGGAGAGTCCATTGCTAAGTTGTTCACTAAACATGGAGCCAAAGTCATAATCGTAGACATCCTGGATGATTTAGGTCATGCTGTTTGTGAAAAAATCGGTCTTGGAATGGCTTCTTTCATCCACTGCGATGTGTGCGTAGAATCCGAAATTGAAAAAGCCGTTAACTTCACCATGGA...

Protein

Download Protein FASTA

273 aa · TkA07G146900|TK1151|PROTEIN

MDNGVEVSGATHRLAGKVALVTGGARGIGESIAKLFTKHGAKVIIVDILDDLGHAVCEKIGLGMASFIHCDVCVESEIEKAVNFTMEKHGKLDIMVNNAAIAGELKLSILENEESDFERVLRVNVTGVFFGTKHAARVMIPNRSGSIITIGSICSTVGGVGSHAYTTSKHAVLGLTKNVAAELGECGIRVNCVSPHFIPTPATLPIVEKHPKLYTNVYHNLKGVVLTEQDVADACLFLASDESKFISGENIALDGGFTAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G146900`
TK1151 ID	TkA07G146900
OH-1004 ID	LXL04_028364
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G146900

Location Chr07:37943935-37945082 (+)

Description Similar to Secoisolariciresinol dehydrogenase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52340`	Involved in the biosynthesis of abscisic acid.	The Arabidopsis sugar-insensitive mutants sis4 and sis5 are defective in abscisic acid synthesis and response.2000 · DOI: 10.1046/j.1365-313x.2000.00833.x A unique short-chain dehydrogenase/reductase in Arabidopsis glucose signaling and abscisic acid biosynthesis and functions.2002 · DOI: 10.1105/tpc.006494 Biochemical characterization of the aba2 and aba3 mutants in Arabidopsis thaliana.1997 · DOI: 10.1104/pp.114.1.161

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028364 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009750 response to fructose Biological Process

GO:0009807 lignan biosynthetic process Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0044283 small molecule biosynthetic process Biological Process

GO:0046211 (+)-camphor biosynthetic process Biological Process

GO:0055129 L-proline biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ag:BAK09296

ath:AT1G52340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.623

Rank 1 · TkA07G146900 · TK1151

Nucleus0.224

Rank 2 · TkA07G146900 · TK1151

Peroxisome0.196

Rank 3 · TkA07G146900 · TK1151

Mitochondrion0.104

Rank 4 · TkA07G146900 · TK1151

Plastid0.043

Rank 5 · TkA07G146900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short17-206 aa

PF08659KR19-172 aa

PF01370Epimerase19-111 aa

PF010733Beta_HSD20-83 aa

PF13561adh_short_C224-258 aa

PF027373HCDH_N24-82 aa

PF01370Epimerase164-184 aa

PF027373HCDH_N191-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G146900	`PF00106`	adh_short	17	206	3.5e-51	174.2
TkA07G146900	`PF08659`	KR	19	172	3.9e-07	30.9
TkA07G146900	`PF01370`	Epimerase	19	111	9.1e-05	22.7
TkA07G146900	`PF01073`	3Beta_HSD	20	83	0.082	12.6
TkA07G146900	`PF13561`	adh_short_C2	24	258	1e-64	219.1
TkA07G146900	`PF02737`	3HCDH_N	24	82	0.03	15.0
TkA07G146900	`PF01370`	Epimerase	164	184	9.1e-05	22.7
TkA07G146900	`PF02737`	3HCDH_N	191	208	0.03	15.0
TkA07G146900	`PF01370`	Epimerase	230	242	9.1e-05	22.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C826`	Arabidopsis thaliana	sp\|Q9C826\|ABA2_ARATH Xanthoxin dehydrogenase	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card