TkA07G145870 | RubberDandelionOmics

Gene overview

TkA07G145870

Reference: TK1151 Chr: Chr07 Coordinates: 37692906-37694675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

855 bp · TkA07G145870|TK1151|cDNA

ATGAGACGGCGACCAGGAATCGGTGGTTTACAGACCGTCGCCGCTGCTAGGGTTCGTACCAATTTCGCATCCCCAGTCGGAATTCACTATCCAGTCGCATTTTCCGGTAATAGTTATTCGCATTCTCTCCCATATATGCTCCTCCGCTCCCATGGATATGCTACTTGTCCAATTGATTCGAGTAAACTTGAAACTTTTGTAGATCCAAGTGTACCGCAAACGGAGGGATTGTCCAGTAGAAATGAGTGCTTGTTTGCAAT...

CDS

Download CDS FASTA

855 bp · TkA07G145870|TK1151|CDS

ATGAGACGGCGACCAGGAATCGGTGGTTTACAGACCGTCGCCGCTGCTAGGGTTCGTACCAATTTCGCATCCCCAGTCGGAATTCACTATCCAGTCGCATTTTCCGGTAATAGTTATTCGCATTCTCTCCCATATATGCTCCTCCGCTCCCATGGATATGCTACTTGTCCAATTGATTCGAGTAAACTTGAAACTTTTGTAGATCCAAGTGTACCGCAAACGGAGGGATTGTCCAGTAGAAATGAGTGCTTGTTTGCAAT...

Protein

Download Protein FASTA

284 aa · TkA07G145870|TK1151|PROTEIN

MRRRPGIGGLQTVAAARVRTNFASPVGIHYPVAFSGNSYSHSLPYMLLRSHGYATCPIDSSKLETFVDPSVPQTEGLSSRNECLFAIIATFPHCYCFSLNDIHAYSLSKRLWLAPRRYLTKPHRSLNVLSHMSFRCYIKLYDSPPTSSTAEDDELAKMPASQKKKLRQKQRKAEARAKKEAEVKNEEANAGGASKWGKEMLRQLIRIHMARSYFFTMMQHEMESQIHYLEQVAYSSVLRAFKAQSDALSWEKEGLITELR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G145870`
TK1151 ID	TkA07G145870
OH-1004 ID	LXL04_002630
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.300
Protein coverage (%)	TK1151 80.634 / OH-1004 46.786 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G145870

Location Chr07:37692906-37694675 (-)

Description Similar to IMPA9: Importin subunit alpha-9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13020`	Probably involved in the regulation of chromatin states (Probable).	No verified direct reference in this release
`At3g12140`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
`At2g44440`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
`At5g06780`	Probably involved in the regulation of chromatin states (Probable).	EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G80410

ath:AT3G12140

ath:AT5G03070

ath:AT5G13020

dosa:Os01g0158000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.420

Rank 1 · TkA07G145870 · TK1151

Cytoplasm0.314

Rank 2 · TkA07G145870 · TK1151

Cell membrane0.148

Rank 3 · TkA07G145870 · TK1151

Plastid0.095

Rank 4 · TkA07G145870 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA07G145870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12569NatA_aux_su130-190 aa

PF20711DUF6825154-192 aa

PF11446DUF2897157-178 aa

PF14772NYD-SP28163-189 aa

PF03735ENT221-275 aa

PF14772NYD-SP28242-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G145870	`PF12569`	NatA_aux_su	130	190	5.2e-10	39.6
TkA07G145870	`PF20711`	DUF6825	154	192	0.66	11.2
TkA07G145870	`PF11446`	DUF2897	157	178	0.42	11.2
TkA07G145870	`PF14772`	NYD-SP28	163	189	0.34	11.6
TkA07G145870	`PF03735`	ENT	221	275	3e-23	82.4
TkA07G145870	`PF14772`	NYD-SP28	242	274	0.34	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K2F0`	Arabidopsis thaliana	sp\|F4K2F0\|EML3_ARATH Protein EMSY-LIKE 3	75.000%	Swiss-Prot	Low
`Q9C7C4`	Arabidopsis thaliana	sp\|Q9C7C4\|EML1_ARATH Protein EMSY-LIKE 1	77.600%	Swiss-Prot	Low
`Q08A72`	Arabidopsis thaliana	sp\|Q08A72\|EML4_ARATH Protein EMSY-LIKE 4	67.600%	Swiss-Prot	Low
`Q9FG29`	Arabidopsis thaliana	sp\|Q9FG29\|EML2_ARATH Protein EMSY-LIKE 2	61.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card