TkA07G145840 | RubberDandelionOmics

Gene overview

TkA07G145840

Reference: TK1151 Chr: Chr07 Coordinates: 37684703-37686519 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · TkA07G145840|TK1151|cDNA

ATGAACACTTTAGACGAAATACAAAGGATAATAGTAAAAGATCTTGCAGAACTGGGACTTATCAAACTACAGCAGGGTAGAAAAGACTTGGTAATTTGTGTTGTAAAAAAAGTACCATCTGTACCCGAAAATATTTGGTTACAGAATAGGCTGTGGGAATCAGATTTAAACAGGGTAGAGATGACATCTGCTCATTTCTTTGATGATTTCCCATCAAGGGATGTGTTTGAAGCAGCCTGCGACCGTGCAAGAGATTACAT...

CDS

Download CDS FASTA

714 bp · TkA07G145840|TK1151|CDS

ATGAACACTTTAGACGAAATACAAAGGATAATAGTAAAAGATCTTGCAGAACTGGGACTTATCAAACTACAGCAGGGTAGAAAAGACTTGGTAATTTGTGTTGTAAAAAAAGTACCATCTGTACCCGAAAATATTTGGTTACAGAATAGGCTGTGGGAATCAGATTTAAACAGGGTAGAGATGACATCTGCTCATTTCTTTGATGATTTCCCATCAAGGGATGTGTTTGAAGCAGCCTGCGACCGTGCAAGAGATTACAT...

Protein

Download Protein FASTA

237 aa · TkA07G145840|TK1151|PROTEIN

MNTLDEIQRIIVKDLAELGLIKLQQGRKDLVICVVKKVPSVPENIWLQNRLWESDLNRVEMTSAHFFDDFPSRDVFEAACDRARDYISLLWDDSKKMRLVVKTKIYVMFVSEKLVIGVGYDCNPMVFARVFGTDELNAYLNKYQLELEPQLEALVGRHSRKPWSKFINAYNQYLVSPEAIDFLDRLTAKEAMLRSIAAKQYHLIKRYKFCETIPCVEDGVEKMKIQCLEGGYVDNYH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G145840`
TK1151 ID	TkA07G145840
OH-1004 ID	LXL04_017303
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.300
Protein coverage (%)	TK1151 97.890 / OH-1004 59.948 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G145840

Location Chr07:37684703-37686519 (+)

Description Similar to TFB2: General transcription and DNA repair factor IIH subunit TFB2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67380`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	Cloning and characterization of two cDNAs encoding casein kinase II catalytic subunits in Arabidopsis thaliana.1993 · DOI: 10.1007/bf00019944 Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105
`At3g50000`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates (By similarity).	No verified direct reference in this release
`At4g17020`	Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9AR27`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`UniProt: B6F107`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017303 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009648 photoperiodism Biological Process

GO:0009908 flower development Biological Process

GO:0010225 response to UV-C Biological Process

GO:0010229 inflorescence development Biological Process

GO:0010332 response to gamma radiation Biological Process

KEGG gene cross-reference

ath:AT3G50000

ath:AT4G17020

ath:AT5G67380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.543

Rank 1 · TkA07G145840 · TK1151

Cytoplasm0.461

Rank 2 · TkA07G145840 · TK1151

Mitochondrion0.065

Rank 3 · TkA07G145840 · TK1151

Cell membrane0.049

Rank 4 · TkA07G145840 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA07G145840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18307Tfb2_C48-104 aa

PF27660SCI1_hairpin151-172 aa

PF18307Tfb2_C193-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G145840	`PF18307`	Tfb2_C	48	104	7.2e-15	55.8
TkA07G145840	`PF27660`	SCI1_hairpin	151	172	0.055	13.8
TkA07G145840	`PF18307`	Tfb2_C	193	212	7.2e-15	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08467`	Arabidopsis thaliana	sp\|Q08467\|CSK21_ARATH Casein kinase II subunit alpha-1	75.300%	Swiss-Prot	Low
`Q08466`	Arabidopsis thaliana	sp\|Q08466\|CSK22_ARATH Casein kinase II subunit alpha-2	77.000%	Swiss-Prot	Low
`Q680U9`	Arabidopsis thaliana	sp\|Q680U9\|TFB2_ARATH General transcription and DNA repair factor IIH subunit TFB2	35.000%	Swiss-Prot	Low
`Q9AR27`	Oryza sativa subsp. indica	sp\|Q9AR27\|HD6_ORYSI Casein kinase II subunit alpha-2	73.000%	Swiss-Prot	Low
`B6F107`	Oryza sativa subsp. japonica	sp\|B6F107\|HD6_ORYSJ Casein kinase II subunit alpha-2	73.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card