TkA07G143590 | RubberDandelionOmics

Gene overview

TkA07G143590

Reference: TK1151 Chr: Chr07 Coordinates: 37074893-37077877 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1649 bp · TkA07G143590|TK1151|cDNA

TTTCAGACCCGTTCAGAAAACAGTGTCAATACCATCAACATCCTCATGAAATAAGACATAAGTGACTATTGTCACGAAATAAATGCAACTATTTTGATGTTTAGATCACAAAAAATAGTATATTAAACAACCACAATTTTCAAGAATAGCAATAAATAAGTAAAAGGAGAAACACGCATTACATACACTATACTATAGTATGTTGAAATGGCCTTCATTGAAAACTCAATAAGGTTTTTCACCGACATAATTTCCGGAGG...

CDS

Download CDS FASTA

834 bp · TkA07G143590|TK1151|CDS

ATGAACCCGCTTACAGGTGAAGAGGAAGAAGGAAACAGCGGGATGGGGCTTCAGCGGCTTCCGCCAGATATTGACACCGTTAATGAGCGAGTTCAGCGGGATGAGGAATACAGCGGCTTCAACGGGGACGACACCGTCCGCCCTAACCATCATAGAGACTCCGGACAGTTTATTGAGATGATGAAGCCTTTAGTTTTTCACCCCAGTGTCATGGCTGCAAGCGTTTTTACTTTATTTAGATTTATCTTATTTTGGTGTGA...

Protein

Download Protein FASTA

277 aa · TkA07G143590|TK1151|PROTEIN

MNPLTGEEEEGNSGMGLQRLPPDIDTVNERVQRDEEYSGFNGDDTVRPNHHRDSGQFIEMMKPLVFHPSVMAASVFTLFRFILFWCEDIYIPIQSFSTREAQKLEPELTGDNESYNIKNIQDADIVLTTPEKFDAVTRFGIKDGGLSFSSDISLVLIDDVHLLTTLEAIVSRIKMIGRSPQMEKTSLAHVRFLAEWLMVPVQGIKRFGEEMRPVKLTTKVFVINDYSYVFDENDIVAYKEGKLFGTQVNSITKKVIIFIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G143590`
TK1151 ID	TkA07G143590
OH-1004 ID	LXL04_006114
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	82.600
Protein coverage (%)	TK1151 41.516 / OH-1004 10.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G143590

Location Chr07:37074893-37077877 (+)

Description Similar to MER3: DExH-box ATP-dependent RNA helicase DExH17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27730`	DNA helicase required for crossover formation, complete synapsis of homologous chromosomes and bivalent formation during meiosis.	Two meiotic crossover classes cohabit in Arabidopsis: one is dependent on MER3,whereas the other one is not.2005 · DOI: 10.1016/j.cub.2005.02.056 The Arabidopsis ROCK-N-ROLLERS gene encodes a homolog of the yeast ATP-dependent DNA helicase MER3 and is required for normal meiotic crossover formation.2005 · DOI: 10.1111/j.1365-313x.2005.02461.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0617500`	DNA helicase required for crossover formation, complete synapsis of homologous chromosomes and bivalent formation during meiosis.	MER3 is required for normal meiotic crossover formation, but not for presynaptic alignment in rice.2009 · DOI: 10.1242/jcs.049080 ZIP4 in homologous chromosome synapsis and crossover formation in rice meiosis.2012 · DOI: 10.1242/jcs.090993

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006114 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003678 DNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G27730

dosa:Os02g0617500

hsa:164045

mmu:330149

xtr:779837

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.447

Rank 1 · TkA07G143590 · TK1151

Cytoplasm0.399

Rank 2 · TkA07G143590 · TK1151

Mitochondrion0.118

Rank 3 · TkA07G143590 · TK1151

Cell membrane0.078

Rank 4 · TkA07G143590 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA07G143590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03332PMM77-94 aa

PF00270DEAD88-166 aa

PF03332PMM219-248 aa

PF00270DEAD229-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G143590	`PF03332`	PMM	77	94	0.0029	18.1
TkA07G143590	`PF00270`	DEAD	88	166	5.5e-05	23.7
TkA07G143590	`PF03332`	PMM	219	248	0.0029	18.1
TkA07G143590	`PF00270`	DEAD	229	255	5.5e-05	23.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5D892`	Arabidopsis thaliana	sp\|Q5D892\|MER3_ARATH ATP-dependent DNA helicase homolog MER3	53.700%	Swiss-Prot	Low
`B6DMK2`	Oryza sativa subsp. japonica	sp\|B6DMK2\|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog	58.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card