TkA07G141800 | RubberDandelionOmics

Gene overview

TkA07G141800

Reference: TK1151 Chr: Chr07 Coordinates: 36614241-36619139 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3167 bp · TkA07G141800|TK1151|cDNA

AAAAAACTTAAAATTTAGAAACCGGAAAATGTGTGCGTGTGTGGGCTCCATGTTAATTTTTTCATCCTTACAAGTTACAAATGCTTTTACTTTCCCTCTATAAATATAACCCGAGAGAACCGGTGCTCAATCAAGCCACTACTTCAACACCCAGGGAGATCAATGGCAATTCAAGCCACTACTTCAACAGCTCCTTCGTCGGCGCCCGCACCCCTTCGACACTCACCATGGCACTCACCGGTACCGTATCTCTTCGGAGG...

CDS

Download CDS FASTA

1281 bp · TkA07G141800|TK1151|CDS

ATGAATCAAAATACCATCTACTTCTGTTTAAAAAGGAAATCTTTATTTTTGAAATCGGCAAAAACGATAGTCATCGAAACCCCTCACCAAATCATGGGTTCCGCCTGCAGCTGTTGTGATTCAGACAAGGTCAATGAAGGGGTTCCGTCAGGAGATGGTCATTCTCCATGGCGGATTTTCACCTTCAAGGAGTTGCATTCAGCCACAAACGGTTTTAGTGAAGATAACAAGCTTGGAGAGGGAGGTTTTGGAAGCGTTTA...

Protein

Download Protein FASTA

426 aa · TkA07G141800|TK1151|PROTEIN

MNQNTIYFCLKRKSLFLKSAKTIVIETPHQIMGSACSCCDSDKVNEGVPSGDGHSPWRIFTFKELHSATNGFSEDNKLGEGGFGSVYWGKTSDGLQIAVKQLKSMNSKAEMEFAVEVEVLGRVRHKNLLGLRGYCASAEQRLIVYDYMPNLSLLSHLHGQFANEVQLDWKKRMKVAIGSAEGLLYLHHEVTPHIIHRDIKASNVLLDSNFDPLVADFGFAKLIPDGVSHMTTRVKGTLGYLAPEYAMWGKVSESCDVYSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G141800`
TK1151 ID	TkA07G141800
OH-1004 ID	LXL04_028315
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 89.906 / OH-1004 37.112 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G141800

Location Chr07:36614241-36619139 (+)

Description Similar to At3g15890: PTI1-like tyrosine-protein kinase At3g15890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15890`	PTI1-like tyrosine-protein kinase At3g15890.	No verified direct reference in this release
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At3g24400`	Proline-rich receptor-like protein kinase PERK2.	No verified direct reference in this release
`At1g68690`	Could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028315 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004715 non-membrane spanning protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G68690

ath:AT3G15890

ath:AT3G24550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.647

Rank 1 · TkA07G141800 · TK1151

Cytoplasm0.273

Rank 2 · TkA07G141800 · TK1151

Nucleus0.239

Rank 3 · TkA07G141800 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA07G141800 · TK1151

Golgi apparatus0.032

Rank 5 · TkA07G141800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase73-341 aa

PF07714PK_Tyr_Ser-Thr75-343 aa

PF03109ABC178-103 aa

PF01636APH149-222 aa

PF03109ABC1175-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G141800	`PF00069`	Pkinase	73	341	2.3e-41	142.7
TkA07G141800	`PF07714`	PK_Tyr_Ser-Thr	75	343	2.2e-43	149.2
TkA07G141800	`PF03109`	ABC1	78	103	0.064	13.1
TkA07G141800	`PF01636`	APH	149	222	0.0051	17.3
TkA07G141800	`PF03109`	ABC1	175	223	0.064	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSC2`	Arabidopsis thaliana	sp\|Q9LSC2\|Y3589_ARATH PTI1-like tyrosine-protein kinase At3g15890	51.900%	Swiss-Prot	High
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	48.800%	Swiss-Prot	Medium
`Q9LK03`	Arabidopsis thaliana	sp\|Q9LK03\|PERK2_ARATH Proline-rich receptor-like protein kinase PERK2	48.500%	Swiss-Prot	Medium
`Q9SX31`	Arabidopsis thaliana	sp\|Q9SX31\|PERK9_ARATH Proline-rich receptor-like protein kinase PERK9	49.700%	Swiss-Prot	Medium
`Q1PEM5`	Arabidopsis thaliana	sp\|Q1PEM5\|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3	47.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card