TkA07G139380 | RubberDandelionOmics

Gene overview

TkA07G139380

Reference: TK1151 Chr: Chr07 Coordinates: 36049598-36050081 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

393 bp · TkA07G139380|TK1151|cDNA

ATGAGTTTCGTGATCAGAGCTTTAATCTTGATTAGCATGATCATATGTCTCACCTCAATTAATACACATGCCCTCTCTGGCCAAGCCACTGTATACGGTCCACCTTATGTTCCTTCATTATGTTTTGGTACGCAAGATCAAGGCGTCATGGTTTCAAAAGCACATAGTAGCTTGTTTGCCAATGGAACAGCCTGTGGAAGGAGGTACCGAGTGCATTGCCTAAGTGGAACCAATAAAGCCATTCGGAACGCATGCACAGG...

CDS

Download CDS FASTA

393 bp · TkA07G139380|TK1151|CDS

ATGAGTTTCGTGATCAGAGCTTTAATCTTGATTAGCATGATCATATGTCTCACCTCAATTAATACACATGCCCTCTCTGGCCAAGCCACTGTATACGGTCCACCTTATGTTCCTTCATTATGTTTTGGTACGCAAGATCAAGGCGTCATGGTTTCAAAAGCACATAGTAGCTTGTTTGCCAATGGAACAGCCTGTGGAAGGAGGTACCGAGTGCATTGCCTAAGTGGAACCAATAAAGCCATTCGGAACGCATGCACAGG...

Protein

Download Protein FASTA

130 aa · TkA07G139380|TK1151|PROTEIN

MSFVIRALILISMIICLTSINTHALSGQATVYGPPYVPSLCFGTQDQGVMVSKAHSSLFANGTACGRRYRVHCLSGTNKAIRNACTGNSVDVTVVGSCSGCAANELQLTEEAFAKIARLALGRVNIEYEQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G139380`
TK1151 ID	TkA07G139380
OH-1004 ID	LXL04_028286
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.700
Protein coverage (%)	TK1151 100.000 / OH-1004 31.311 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G139380`
Location	Chr07:36049598-36050081 (+)
Description	Similar to CjBAp12: EG45-like domain containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028286` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009627 systemic acquired resistance Biological Process GO:0009828 plant-type cell wall loosening Biological Process GO:0010230 alternative respiration Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005576 extracellular region Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0016020 membrane Cellular Component GO:0048046 apoplast Cellular Component GO:0051428 peptide hormone receptor binding Molecular Function
KEGG gene cross-reference	ath:AT2G18660 dosa:Os04g0552000 dosa:Os05g0246300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.491

Rank 1 · TkA07G139380 · TK1151

Lysosome / Vacuole0.135

Rank 2 · TkA07G139380 · TK1151

Cytoplasm0.122

Rank 3 · TkA07G139380 · TK1151

Endoplasmic reticulum0.100

Rank 4 · TkA07G139380 · TK1151

Cell membrane0.063

Rank 5 · TkA07G139380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26302YhzF1-36 aa

PF29515Expansin_N32-118 aa

PF03330DPBB_154-128 aa

PF01106NifU86-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G139380	`PF26302`	YhzF	1	36	0.25	12.3
TkA07G139380	`PF29515`	Expansin_N	32	118	0.36	11.6
TkA07G139380	`PF03330`	DPBB_1	54	128	1.4e-13	51.5
TkA07G139380	`PF01106`	NifU	86	109	0.054	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card