TkA07G132300 | RubberDandelionOmics

Gene overview

TkA07G132300

Reference: TK1151 Chr: Chr07 Coordinates: 34318243-34319362 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA07G132300|TK1151|cDNA

ATGAAGCTTCCCACAATGAATCAGACAGTCTCTGAATTGAAGGATTTTGTTAAAAAGCTCAACTCATTGCCAGAAATGACTAGGCACATAAATCTTGCTCAACATTTATCCACGCTTACTTCAAAGCCTTGGTTTCTTGGACGACTTGACATGGAACATACTATTGTGGAGGCCGAGAGCTATGACATATGCTTGGATTACATTGAAGAGATGATTCATAAGCAGGAGCCTCTTGTTAGTGTTCTAAGACTCGTTATGTA...

CDS

Download CDS FASTA

474 bp · TkA07G132300|TK1151|CDS

ATGAAGCTTCCCACAATGAATCAGACAGTCTCTGAATTGAAGGATTTTGTTAAAAAGCTCAACTCATTGCCAGAAATGACTAGGCACATAAATCTTGCTCAACATTTATCCACGCTTACTTCAAAGCCTTGGTTTCTTGGACGACTTGACATGGAACATACTATTGTGGAGGCCGAGAGCTATGACATATGCTTGGATTACATTGAAGAGATGATTCATAAGCAGGAGCCTCTTGTTAGTGTTCTAAGACTCGTTATGTA...

Protein

Download Protein FASTA

157 aa · TkA07G132300|TK1151|PROTEIN

MKLPTMNQTVSELKDFVKKLNSLPEMTRHINLAQHLSTLTSKPWFLGRLDMEHTIVEAESYDICLDYIEEMIHKQEPLVSVLRLVMYAEPSIRPDDSRYGENPNRLQRHTQFQVILKPDPGNSQDLLIRSLSALGIDVNEHDIRFVEDNWESPVLGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G132300`
TK1151 ID	TkA07G132300
OH-1004 ID	LXL04_028229
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G132300

Location Chr07:34318243-34319362 (-)

Description Similar to EDD1: Glycine--tRNA ligase, chloroplastic/mitochondrial 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48110`	Catalyzes the attachment of glycine to tRNA(Gly).	No verified direct reference in this release
`At3g54860`	Involved in regulating membrane fusion at the tonoplast and the prevacuolar compartment.	The AtC-VPS protein complex is localized to the tonoplast and the prevacuolar compartment in arabidopsis.2003 · DOI: 10.1091/mbc.e02-08-0509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028229 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006426 glycyl-tRNA aminoacylation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0007033 vacuole organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT3G48110

ath:AT3G54860

tma:TM0216

tmi:THEMA_03645

tmm:Tmari_0214

tmw:THMA_0223

tpt:Tpet_0708

trq:TRQ2_0732

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.663

Rank 1 · TkA07G132300 · TK1151

Mitochondrion0.268

Rank 2 · TkA07G132300 · TK1151

Cytoplasm0.144

Rank 3 · TkA07G132300 · TK1151

Nucleus0.055

Rank 4 · TkA07G132300 · TK1151

Peroxisome0.046

Rank 5 · TkA07G132300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00995Sec17-87 aa

PF01316Arg_repressor69-82 aa

PF02091tRNA-synt_2e85-157 aa

PF01316Arg_repressor104-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G132300	`PF00995`	Sec1	7	87	3.8e-11	43.6
TkA07G132300	`PF01316`	Arg_repressor	69	82	0.074	13.5
TkA07G132300	`PF02091`	tRNA-synt_2e	85	157	1.1e-34	120.7
TkA07G132300	`PF01316`	Arg_repressor	104	139	0.074	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L785`	Arabidopsis thaliana	sp\|Q8L785\|SYGM2_ARATH Glycine--tRNA ligase, chloroplastic/mitochondrial 2	90.400%	Swiss-Prot	Low
`Q94KJ7`	Arabidopsis thaliana	sp\|Q94KJ7\|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog	78.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card