TkA07G131690 | RubberDandelionOmics

Gene overview

TkA07G131690

Reference: TK1151 Chr: Chr07 Coordinates: 34162015-34165055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2174 bp · TkA07G131690|TK1151|cDNA

TAAAAATTTCTATGAAGAGGGATTCACAAAAAACACATTCATGTCATCGAATAATCGCTCTCTCCTCATCCATACCGACCACTAGTCATCATCTTTCTTTCCGCCTTCATATTTAAACTACATACACTTGCTTACATTTGAAAATGGCAGCAGCAGCACCCATTAGACTAGCATCCTCTTCTTCTCTTACTCTTGTTGCTTCAACTTGTTCGTCTTCCTTCATTTTCACCAAGTTTAGATCTATACCCCATCTGCGCTTT...

CDS

Download CDS FASTA

1794 bp · TkA07G131690|TK1151|CDS

ATGGCAGCAGCAGCACCCATTAGACTAGCATCCTCTTCTTCTCTTACTCTTGTTGCTTCAACTTGTTCGTCTTCCTTCATTTTCACCAAGTTTAGATCTATACCCCATCTGCGCTTTTCATTTTCAGTAACCACCGCTGCTAATGCTACTTCTGGAAACTCCTTGTTGTTCTGTTCTCGAAGAGGGAAACGTATGGCTCATACCCTTGCCAAGGCCACTCTTGGCCTCACTCATCCCGCCGAAATCGAATCCCACAAGAT...

Protein

Download Protein FASTA

597 aa · TkA07G131690|TK1151|PROTEIN

MAAAAPIRLASSSSLTLVASTCSSSFIFTKFRSIPHLRFSFSVTTAANATSGNSLLFCSRRGKRMAHTLAKATLGLTHPAEIESHKISLAAKDIDLVEWKGDILAVGVTEKDMIKDENSKFQNVTLKKLDSQLHGLLSQVSIEEDFTGRVGQSTILRISGHGTKRVSLVGLGKGPTGSSSSTSAYRSLGESIATSAKASQANNVAVALASSQDLTPEFKLTTASAIATGALLGTYEDNRFKSEPKKLPALKSIDFLGLGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G131690`
TK1151 ID	TkA07G131690
OH-1004 ID	LXL04_028220
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 99.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G131690

Location Chr07:34162015-34165055 (-)

Description Similar to LAPA2: Leucine aminopeptidase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g30920`	Presumably involved in the processing and regular turnover of intracellular proteins.	Plant leucine aminopeptidases moonlight as molecular chaperones to alleviate stress-induced damage.2012 · DOI: 10.1074/jbc.m111.309500
`At2g24200`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release
`At4g30910`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0794700`	Presumably involved in the processing and regular turnover of intracellular proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028220 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009611 response to wounding Biological Process

GO:0010150 leaf senescence Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0043171 peptide catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G24200

ath:AT4G30910

ath:AT4G30920

dosa:Os02g0794700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.803

Rank 1 · TkA07G131690 · TK1151

Mitochondrion0.196

Rank 2 · TkA07G131690 · TK1151

Cytoplasm0.101

Rank 3 · TkA07G131690 · TK1151

Peroxisome0.066

Rank 4 · TkA07G131690 · TK1151

Nucleus0.030

Rank 5 · TkA07G131690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02789Peptidase_M17_N105-243 aa

PF00883Peptidase_M17281-587 aa

PF02814UreE_N295-310 aa

PF02814UreE_N425-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G131690	`PF02789`	Peptidase_M17_N	105	243	2.7e-25	89.5
TkA07G131690	`PF00883`	Peptidase_M17	281	587	6.7e-116	387.7
TkA07G131690	`PF02814`	UreE_N	295	310	0.096	13.0
TkA07G131690	`PF02814`	UreE_N	425	446	0.096	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944P7`	Arabidopsis thaliana	sp\|Q944P7\|AMPL2_ARATH Leucine aminopeptidase 2, chloroplastic	71.800%	Swiss-Prot	High
`P30184`	Arabidopsis thaliana	sp\|P30184\|AMPL1_ARATH Leucine aminopeptidase 1	73.500%	Swiss-Prot	High
`Q8RX72`	Arabidopsis thaliana	sp\|Q8RX72\|AMPL3_ARATH Leucine aminopeptidase 3, chloroplastic	68.800%	Swiss-Prot	High
`Q6K669`	Oryza sativa subsp. japonica	sp\|Q6K669\|AMPL2_ORYSJ Leucine aminopeptidase 2, chloroplastic	73.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card