TkA07G127120 | RubberDandelionOmics

Gene overview

TkA07G127120

Reference: TK1151 Chr: Chr07 Coordinates: 32853024-32855030 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1196 bp · TkA07G127120|TK1151|cDNA

TTTACTTCGTCGGGTTTGGCGACGTCTAGATGATTTCTAGCGTACGCAACATGTAGAAGCGAAGTCGGTAGATTTAAAATACGAATCCATTCCCCCTTTTCTCGTTCATAAAGCAAAAACCTAAAAGATTTGTTCCCCTATATTCGATCGTGAGTACAACGCAATTCAGAAATTTATATCTGGAATCACCATCTATCCTTCTTATCGACCTACGATTTCGGCACTCATTTTTGATTGCTGTCTATCGAATTCACACAGAC...

CDS

Download CDS FASTA

606 bp · TkA07G127120|TK1151|CDS

ATGAAGATCACAGCGTTGCTGGTGTTGAAGTGTGATGCGAGACCCGACGGGTCGGATCCCGTGATACTGGCAAACGCGACGGATGTGAATCATTTTGGGTACTTCCAGAGGGTCACCGTCAGACAGTTCATCGTCTTTGTTGGTCGGACCGTCGCCAAACGCACCCCTCCTGATCAACGCCACTCCGTTCAGCACGAAGAGTATAAGGTGCATTCATACAACAGAAATGGCTTATGTGTGGTGGGATTCATGGATGATCA...

Protein

Download Protein FASTA

201 aa · TkA07G127120|TK1151|PROTEIN

MKITALLVLKCDARPDGSDPVILANATDVNHFGYFQRVTVRQFIVFVGRTVAKRTPPDQRHSVQHEEYKVHSYNRNGLCVVGFMDDHYPVRSAFSVLNKVMDEYQKCFGDSWRTIQADSTEAWPYLNEALTKFQDPGEADKLLKIQRELDETKIILHKTIDSVLERGEKLDSLVEKSSDLSAASQMFYKQAKKTNQCCSIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G127120`
TK1151 ID	TkA07G127120
OH-1004 ID	LXL04_022271
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.800
Protein coverage (%)	TK1151 45.771 / OH-1004 43.511 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G127120

Location Chr07:32853024-32855030 (+)

Description Similar to Triosephosphate isomerase, cytosolic (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58060`	May be involved in the secretory pathway (By similarity).	YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.2005 · DOI: 10.1016/j.jmb.2005.04.061
`At5g58180`	Involved in the secretory pathway.	YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.2005 · DOI: 10.1016/j.jmb.2005.04.061

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022271 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0019563 glycerol catabolic process Biological Process

GO:0046166 glyceraldehyde-3-phosphate biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

KEGG gene cross-reference

ath:AT3G55440

zma:100272481

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.421

Rank 1 · TkA07G127120 · TK1151

Golgi apparatus0.291

Rank 2 · TkA07G127120 · TK1151

Lysosome / Vacuole0.268

Rank 3 · TkA07G127120 · TK1151

Cell membrane0.204

Rank 4 · TkA07G127120 · TK1151

Endoplasmic reticulum0.183

Rank 5 · TkA07G127120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774Longin35-119 aa

PF24304AcrIIA461-121 aa

PF21831DUF689190-167 aa

PF05299Peptidase_M6192-128 aa

PF00957Synaptobrevin142-196 aa

PF05299Peptidase_M61155-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G127120	`PF13774`	Longin	35	119	9.5e-17	61.6
TkA07G127120	`PF24304`	AcrIIA4	61	121	0.002	19.1
TkA07G127120	`PF21831`	DUF6891	90	167	0.22	12.1
TkA07G127120	`PF05299`	Peptidase_M61	92	128	0.2	12.8
TkA07G127120	`PF00957`	Synaptobrevin	142	196	1.5e-14	54.3
TkA07G127120	`PF05299`	Peptidase_M61	155	196	0.2	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZRD6`	Arabidopsis thaliana	sp\|Q9ZRD6\|YKT61_ARATH VAMP-like protein YKT61	81.600%	Swiss-Prot	High
`Q9LVM9`	Arabidopsis thaliana	sp\|Q9LVM9\|YKT62_ARATH VAMP-like protein YKT62	71.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card