TkA07G121940 | RubberDandelionOmics

Gene overview

TkA07G121940

Reference: TK1151 Chr: Chr07 Coordinates: 31641613-31645435 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1716 bp · TkA07G121940|TK1151|cDNA

TCAGTAGCAACGATGTGTGCACCATCAGGTGTAGTTGGTGTCTTTGACATCAATTGCATGATATAGCTTTTAGGGACGATAGCTTTAGGGACAACAATAATCGTCGCTAAAAAGTAGGGTTTAGCGAGGACATGTTCTCGCAATACAGTTTTAAAATTTTCAACTTTAGGAAAAAGATGCTACGCTGTCGTTTGGATATTCTTATTTGCCCTAAACTATGACTTCCAGCCACGATGACCTACAGATCCAATTTCAGCTTC...

CDS

Download CDS FASTA

474 bp · TkA07G121940|TK1151|CDS

ATGGATTTCAAAGGTTTGAGAAGATCAAAAACTCAAGTAGGCAAAGTAGGCAGCTGGAAGAACTCATTGGAAAGATGCGGGAATGTCAAAGAGTTGAACTCTTATGTTGCACTTAAAAAGTACAACATTGAAAACAAAAGAGTTGATTTGTTTGGAGGACCTGGTGAGGGATTTGAGGAAGATAATGGCTTGCTAGTCTCATCCATGACAAATCAACAACTAATGGACAACTGTCACCACATGATGGACGAAACTGACCA...

Protein

Download Protein FASTA

157 aa · TkA07G121940|TK1151|PROTEIN

MDFKGLRRSKTQVGKVGSWKNSLERCGNVKELNSYVALKKYNIENKRVDLFGGPGEGFEEDNGLLVSSMTNQQLMDNCHHMMDETDQAIEAFRKVVHETVTVGTETAATLKAQVASLLHDDVLDDVDTRCDIANSDRGRASSCWENNANEHVSKTTY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G121940`
TK1151 ID	TkA07G121940
OH-1004 ID	LXL04_000233
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.600
Protein coverage (%)	TK1151 78.981 / OH-1004 43.643 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G121940

Location Chr07:31641613-31645435 (+)

Description Similar to NPSN11: Novel plant SNARE 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35190`	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation.	No verified direct reference in this release
`At1g48240`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At3g17440`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000233 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0015031 protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G48240

ath:AT1G75850

ath:AT2G17790

ath:AT2G35190

ath:AT3G17440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA07G121940 · TK1151

Nucleus0.314

Rank 2 · TkA07G121940 · TK1151

Cell membrane0.116

Rank 3 · TkA07G121940 · TK1151

Mitochondrion0.109

Rank 4 · TkA07G121940 · TK1151

Endoplasmic reticulum0.083

Rank 5 · TkA07G121940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515TPR_133-42 aa

PF10669Phage_Gp2360-97 aa

PF11791Aconitase_B_N62-114 aa

PF00834Ribul_P_3_epim67-114 aa

PF00515TPR_177-95 aa

PF00348polyprenyl_synt112-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G121940	`PF00515`	TPR_1	33	42	0.14	12.7
TkA07G121940	`PF10669`	Phage_Gp23	60	97	0.032	15.3
TkA07G121940	`PF11791`	Aconitase_B_N	62	114	0.18	12.5
TkA07G121940	`PF00834`	Ribul_P_3_epim	67	114	0.03	14.4
TkA07G121940	`PF00515`	TPR_1	77	95	0.14	12.7
TkA07G121940	`PF00348`	polyprenyl_synt	112	129	0.26	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A9`	Arabidopsis thaliana	sp\|Q944A9\|NPS11_ARATH Novel plant SNARE 11	60.600%	Swiss-Prot	Medium
`Q9LNH6`	Arabidopsis thaliana	sp\|Q9LNH6\|NPS12_ARATH Novel plant SNARE 12	46.400%	Swiss-Prot	Medium
`Q9LRP1`	Arabidopsis thaliana	sp\|Q9LRP1\|NPS13_ARATH Novel plant SNARE 13	50.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card