TkA07G116460 | RubberDandelionOmics

Gene overview

TkA07G116460

Reference: TK1151 Chr: Chr07 Coordinates: 30246932-30247454 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA07G116460|TK1151|cDNA

ATTAATAGAAAGCAAAGTGGACTGCGAATTGAGTTTCCATATCCGCACACTTTACTCTCTCAGTCAACCCTTTCCCTGTCCAGCGATAAAAAAATGGCGCCCCCTAGTGTTCTGAAATATGAAACGGAGGAACACGTCGCTGTCGCTCTTGCCAAATATGTCGCCGATTTGTCCGCTAAGTTTATCGCCGTCAATGGTTCTTTCTCCGTTGTAGTTTCCGGTGGTACTTTAATCGATACTATGAGGAAATTACTGGAACC...

CDS

Download CDS FASTA

381 bp · TkA07G116460|TK1151|CDS

ATTAATAGAAAGCAAAGTGGACTGCGAATTGAGTTTCCATATCCGCACACTTTACTCTCTCAGTCAACCCTTTCCCTGTCCAGCGATAAAAAAATGGCGCCCCCTAGTGTTCTGAAATATGAAACGGAGGAACACGTCGCTGTCGCTCTTGCCAAATATGTCGCCGATTTGTCCGCTAAGTTTATCGCCGTCAATGGTTCTTTCTCCGTTGTAGTTTCCGGTGGTACTTTAATCGATACTATGAGGAAATTACTGGAACC...

Protein

Download Protein FASTA

127 aa · TkA07G116460|TK1151|PROTEIN

INRKQSGLRIEFPYPHTLLSQSTLSLSSDKKMAPPSVLKYETEEHVAVALAKYVADLSAKFIAVNGSFSVVVSGGTLIDTMRKLLEPPYVTSIDWSKWLIFYLDERVVPLDHPHCNHKLAYDGFLSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G116460`
TK1151 ID	TkA07G116460
OH-1004 ID	LXL04_021568
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	55.600
Protein coverage (%)	TK1151 85.039 / OH-1004 31.889 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G116460

Location Chr07:30246932-30247454 (-)

Description Similar to PGL3: 6-phosphogluconolactonase 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24400`	Catalyzes the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.	No verified direct reference in this release
`At3g49360`	Catalyzes the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.	No verified direct reference in this release
`At5g24410`	Catalyzes the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z3C4`	Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.	No verified direct reference in this release
`Os09g0529100`	Hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006098 pentose-phosphate shunt Biological Process

GO:0009051 pentose-phosphate shunt, oxidative branch Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0071461 cellular response to redox state Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT5G24400

dosa:Os08g0547100

dosa:Os09g0529100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA07G116460 · TK1151

Nucleus0.319

Rank 2 · TkA07G116460 · TK1151

Plastid0.105

Rank 3 · TkA07G116460 · TK1151

Mitochondrion0.093

Rank 4 · TkA07G116460 · TK1151

Peroxisome0.080

Rank 5 · TkA07G116460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01182Glucosamine_iso42-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G116460	`PF01182`	Glucosamine_iso	42	126	3.6e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WW2`	Arabidopsis thaliana	sp\|Q84WW2\|6PGL3_ARATH 6-phosphogluconolactonase 3, chloroplastic	51.900%	Swiss-Prot	High
`Q8LG70`	Arabidopsis thaliana	sp\|Q8LG70\|6PGL2_ARATH Probable 6-phosphogluconolactonase 2	58.300%	Swiss-Prot	High
`Q9FIN1`	Arabidopsis thaliana	sp\|Q9FIN1\|6PGL4_ARATH Probable 6-phosphogluconolactonase 4	52.800%	Swiss-Prot	High
`A2Z3C4`	Oryza sativa subsp. indica	sp\|A2Z3C4\|6PGL4_ORYSI Probable 6-phosphogluconolactonase 4, chloroplastic	62.600%	Swiss-Prot	High
`Q69NG5`	Oryza sativa subsp. japonica	sp\|Q69NG5\|6PGL4_ORYSJ Probable 6-phosphogluconolactonase 4, chloroplastic	62.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card