TkA07G115150 | RubberDandelionOmics

Gene overview

TkA07G115150

Reference: TK1151 Chr: Chr07 Coordinates: 29845294-29851647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1508 bp · TkA07G115150|TK1151|cDNA

ATTTGAATTTCTTCACACGCAGAACCATCAGAGATTTGGAGAGGAGAACGCAAGGACCGTGGTAATATGGGTGCAGTGAACATCTTATACGACGTGGAAGTCTCGGATGAAGTTCGTAATGCCTGTAACTTTGAGGCTGTTCGTTCTTCACTCACCGTCGATCATACCCTTCCTTTGCCGGAGATGAAACCTCAACTCATAGATCTTTGCAAGGACCTGTTTAAGCAGTGGTCAAATTTGGATAAATCACATTTTTCTGT...

CDS

Download CDS FASTA

1119 bp · TkA07G115150|TK1151|CDS

ATGGGTGCAGTGAACATCTTATACGACGTGGAAGTCTCGGATGAAGTTCGTAATGCCTGTAACTTTGAGGCTGTTCGTTCTTCACTCACCGTCGATCATACCCTTCCTTTGCCGGAGATGAAACCTCAACTCATAGATCTTTGCAAGGACCTGTTTAAGCAGTGGTCAAATTTGGATAAATCACATTTTTCTGTTGAGAAAGTTTCTGGTGGCATTACAAATCTTTTACTTAAGGTATCTGTAAAGGAAGAAAATGGGAA...

Protein

Download Protein FASTA

372 aa · TkA07G115150|TK1151|PROTEIN

MGAVNILYDVEVSDEVRNACNFEAVRSSLTVDHTLPLPEMKPQLIDLCKDLFKQWSNLDKSHFSVEKVSGGITNLLLKVSVKEENGNMVHVTVRLYGPNTEYVINRERELQALHHLSAAGFGPKLLGVFENGMVQSFIHAGTLETQDMRNPNLAAEIAKQLNRFHQVDVPGSKEPQLWNDIFKFYKKASNLTFDDYEKQKKYAQISFDELLSEILQLKELTGHLNAPVVFAHNDLLCGNLMFNNDQGKLYFIDFEYGSYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G115150`
TK1151 ID	TkA07G115150
OH-1004 ID	LXL04_018282
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.900
Protein coverage (%)	TK1151 99.462 / OH-1004 92.029 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G115150

Location Chr07:29845294-29851647 (-)

Description Similar to EMB1187: Probable ethanolamine kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26830`	Involved in phospholipid biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006646 phosphatidylethanolamine biosynthetic process Biological Process

GO:0008654 phospholipid biosynthetic process Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0016310 phosphorylation Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004305 ethanolamine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G26830

ddi:DDB_G0274955

hsa:55224

mmu:214253

rno:360843

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · TkA07G115150 · TK1151

Nucleus0.400

Rank 2 · TkA07G115150 · TK1151

Mitochondrion0.104

Rank 3 · TkA07G115150 · TK1151

Cell membrane0.090

Rank 4 · TkA07G115150 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA07G115150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22592FCaBP_EF-hand46-76 aa

PF01633Choline_kinase65-356 aa

PF01636APH66-271 aa

PF02958EcKL139-267 aa

PF22592FCaBP_EF-hand203-233 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G115150	`PF22592`	FCaBP_EF-hand	46	76	0.032	15.3
TkA07G115150	`PF01633`	Choline_kinase	65	356	5.5e-97	325.4
TkA07G115150	`PF01636`	APH	66	271	1.4e-17	64.9
TkA07G115150	`PF02958`	EcKL	139	267	0.00015	21.9
TkA07G115150	`PF22592`	FCaBP_EF-hand	203	233	0.032	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81024`	Arabidopsis thaliana	sp\|O81024\|EKI_ARATH Probable ethanolamine kinase	65.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card