Gene Card
Gene overview
cDNA / CDS / Protein Sequences
764 bp · TkA07G108970|TK1151|cDNA
CCAGCCTCCCCTTAAATTAAATATTCTTCTTCCTAGTTCCCACAATACATTCCAACAAAACCCTGAGTACCCCTCTCCTCCTCCGTTTAGACTGTCTTAAACCCTAAAAGATGGGAGACGAAGAACAAACCAAGAACAACGAAGTAAAAACAGTCCATCGCAACGGCCAGCAATCGGGCAAGAAGAGAAAAAAACAGAAAGAAGTTGCCATCTTCGGCAACTACAGGAACTACTACACTTATCGAATTGAACAAGGGTTG...
852 bp · TkA07G108970|TK1151|CDS
ATGGGAGACGAAGAACAAACCAAGAACAACGAAGTAAAAACAGTCCATCGCAACGGCCAGCAATCGGGCAAGAAGAGAAAAAAACAGAAAGAAGTTGCCATCTTCGGCAACTACAGGAACTACTACACTTATCGAATTGAACAAGGGTTGGATGAAGACCCTAGGATAAAGATTATGAAAAAGGAATGGTTTGAAGGGAAGACTTGTATTGACATTGGTTGCAATAGTGGACTGATAACCATTACAATCGCAAAAAACTT...
Protein
Download Protein FASTA283 aa · TkA07G108970|TK1151|PROTEIN
MGDEEQTKNNEVKTVHRNGQQSGKKRKKQKEVAIFGNYRNYYTYRIEQGLDEDPRIKIMKKEWFEGKTCIDIGCNSGLITITIAKNFGCKKILGVDIDSARIEDAHWNLRKIVKMSERKNQLLMVDKSKDAETNAITITTSTDKTTSEISGDLFNRVSFKKDNFVQSFSTPGEKYDTILCLSVTKWVHLNWGDEGLITLFSKVYRLLEPGGVFILEPQPWKSYVSNRQVSEVASANYKNLEIFPDKFQEILLDKIGFREI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G108970 |
|---|---|
| TK1151 ID | TkA07G108970 |
| OH-1004 ID | LXL04_027955 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G108970 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr07:28242984-28245132 (+) | ||||||
| Description | Similar to At5g51130: Probable RNA methyltransferase At5g51130 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0001510 RNA methylation Biological Process GO:0016073 snRNA metabolic process Biological Process GO:0032259 methylation Biological Process GO:0040031 snRNA modification Biological Process GO:1900087 positive regulation of G1/S transition of mitotic cell cycle Biological Process GO:1904871 positive regulation of protein localization to Cajal body Biological Process GO:1905382 positive regulation of snRNA transcription by RNA polymerase II Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003723 RNA binding Molecular Function | ||||||
| KEGG gene cross-reference | ath:AT5G51130 cel:CELE_Y17G7B.18 hsa:56257 mmu:231803 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12847Methyltransf_1855-112 aaPF05175MTS59-111 aaPF02353CMAS60-110 aaPF13489Methyltransf_2364-217 aaPF06325PrmA64-111 aaPF01209Ubie_methyltran64-137 aaPF13847Methyltransf_3165-111 aaPF01728FtsJ65-118 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G108970 | PF12847 | Methyltransf_18 | 55 | 112 | 0.00026 | 21.7 |
| TkA07G108970 | PF05175 | MTS | 59 | 111 | 0.0014 | 19.0 |
| TkA07G108970 | PF02353 | CMAS | 60 | 110 | 0.00011 | 22.4 |
| TkA07G108970 | PF13489 | Methyltransf_23 | 64 | 217 | 1.1e-10 | 42.1 |
| TkA07G108970 | PF06325 | PrmA | 64 | 111 | 6.1e-07 | 29.9 |
| TkA07G108970 | PF01209 | Ubie_methyltran | 64 | 137 | 0.079 | 13.0 |
| TkA07G108970 | PF13847 | Methyltransf_31 | 65 | 111 | 5.7e-07 | 30.1 |
| TkA07G108970 | PF01728 | FtsJ | 65 | 118 | 0.0049 | 17.5 |
| TkA07G108970 | PF02390 | Methyltransf_4 | 67 | 107 | 0.00016 | 21.9 |
| TkA07G108970 | PF08242 | Methyltransf_12 | 70 | 111 | 1.6e-11 | 45.5 |
| TkA07G108970 | PF13649 | Methyltransf_25 | 70 | 110 | 4.4e-09 | 37.6 |
| TkA07G108970 | PF08241 | Methyltransf_11 | 70 | 110 | 3.5e-07 | 31.5 |
| TkA07G108970 | PF29244 | Methyltransf_ANTKMT | 71 | 111 | 0.0067 | 17.6 |
| TkA07G108970 | PF00107 | ADH_zinc_N | 77 | 105 | 0.049 | 14.3 |
| TkA07G108970 | PF05175 | MTS | 118 | 158 | 0.0014 | 19.0 |
| TkA07G108970 | PF02353 | CMAS | 133 | 245 | 0.00011 | 22.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q6NPC9 | Arabidopsis thaliana | sp|Q6NPC9|BIN3D_ARATH Probable RNA methyltransferase At5g51130 | 58.700% | Swiss-Prot | High |