TkA07G108400 | RubberDandelionOmics

Gene overview

TkA07G108400

Reference: TK1151 Chr: Chr07 Coordinates: 28090813-28093500 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2372 bp · TkA07G108400|TK1151|cDNA

TTAAAAAATATGGTGGGCCTTTGTCTTATTATATCATAAAATTTCCATTGCCACATCTTCATGCATCATCCCATCTTGCATAATTCTTTCAGCTTCCCTAGTTCGTCCTCTTCTTTTGAAAGTTTATTTCCTTATCGATGTGGCCGTTGCAATTGCCTCCAAATAGATTGGTTTTTCTCTACAAGGGTGATAATTGCCAATAGTCCTTGAGCTTTTCTACTTTTCAATTCCACCCCTTGTAGATTATGATTGTCTACTTT...

CDS

Download CDS FASTA

1941 bp · TkA07G108400|TK1151|CDS

ATGGCTCTAACGGTAAAAACCATTATCCAATTCCCAATTTTTGCACCACCACCATCTAACCACCACAACAACCGCACGACCACCGTAATCCGCTTCTCACGGTGGAACAACGCCAACGCCCAGAAATTCATCCGCCATGAACGCACTCAGAAAGAAACCGAAGACCAACTACGTTTCCACAAACGCTTCGAATCCGCCGGAAGAATTGCCAATCTCCAACCCACCACCACCACACCGCCACCATTCAAGTCCACCGGGAC...

Protein

Download Protein FASTA

646 aa · TkA07G108400|TK1151|PROTEIN

MALTVKTIIQFPIFAPPPSNHHNNRTTTVIRFSRWNNANAQKFIRHERTQKETEDQLRFHKRFESAGRIANLQPTTTTPPPFKSTGTPSAPSRPSIPGKKSKYSKPPQNPKPTSHPAFQRIVRLRKIPGEIEDDTGIKVSDNGLSYIIPEAPFEFQYSYTETPKVKPIKLREPPIAPFGPGTMPRPWTGKKPLPPSKKKVEFDSFTLPPPHKKGVKPVQAPGPFLPGSGPKYVQSREEVLGEPLSKEEIDALIKGCLKSE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G108400`
TK1151 ID	TkA07G108400
OH-1004 ID	LXL04_027948
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G108400

Location Chr07:28090813-28093500 (+)

Description Similar to At2g20020: CRS2-associated factor 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20020`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release
`At1g23400`	Essential protein required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0495900`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release
`Os01g0323300`	Required for the splicing of group IIB introns in chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027948 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G23400

ath:AT2G20020

dosa:Os01g0495900

zma:542118

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.902

Rank 1 · TkA07G108400 · TK1151

Nucleus0.081

Rank 2 · TkA07G108400 · TK1151

Mitochondrion0.071

Rank 3 · TkA07G108400 · TK1151

Cytoplasm0.058

Rank 4 · TkA07G108400 · TK1151

Cell membrane0.023

Rank 5 · TkA07G108400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01985CRS1_YhbY244-327 aa

PF05162Ribosomal_L41280-293 aa

PF01985CRS1_YhbY362-445 aa

PF20523DUF6738456-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G108400	`PF01985`	CRS1_YhbY	244	327	5.8e-39	133.0
TkA07G108400	`PF05162`	Ribosomal_L41	280	293	0.32	11.7
TkA07G108400	`PF01985`	CRS1_YhbY	362	445	5.8e-39	133.0
TkA07G108400	`PF20523`	DUF6738	456	503	2.2	9.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL79`	Arabidopsis thaliana	sp\|Q9SL79\|CAF1P_ARATH CRS2-associated factor 1, chloroplastic	48.600%	Swiss-Prot	Medium
`Q9LDA9`	Arabidopsis thaliana	sp\|Q9LDA9\|CAF2P_ARATH CRS2-associated factor 2, chloroplastic	60.500%	Swiss-Prot	Medium
`Q5VMQ5`	Oryza sativa subsp. japonica	sp\|Q5VMQ5\|CAF1P_ORYSJ CRS2-associated factor 1, chloroplastic	47.400%	Swiss-Prot	Medium
`Q657G7`	Oryza sativa subsp. japonica	sp\|Q657G7\|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic	51.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card