TkA07G104370 | RubberDandelionOmics

Gene overview

TkA07G104370

Reference: TK1151 Chr: Chr07 Coordinates: 27123702-27134067 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · TkA07G104370|TK1151|cDNA

GAAAACAGGCAGCTTTTTATTGGTATTCAACCAAGCTGATGTCAAGTGTCAACTACCACCAACGAAAATATCACCGGCTTAGCCCCCTCTCTCTCTAACTCTGTGCGAGTGAGAGAAAAATGGAGGAACAGAGTATAAAAACTCCATTTTTGAAACCTGCAGAAGATTGCAAAAACAGGAAGAGATGGAGAACAGCTATTTGGCTCTTCATTTCACTCACAGCTTTAATTTTTATCTTCCTGACATTGAGTCTAGAACTA...

CDS

Download CDS FASTA

1752 bp · TkA07G104370|TK1151|CDS

ATGGAGGAACAGAGTATAAAAACTCCATTTTTGAAACCTGCAGAAGATTGCAAAAACAGGAAGAGATGGAGAACAGCTATTTGGCTCTTCATTTCACTCACAGCTTTAATTTTTATCTTCCTGACATTGAGTCTAGAACTAGAAGATTGGAAGAAGCATAACAATGGAAAAGGAAATAAAGCAAGCAATAAGGTACAATCAGGCGATGAAGTCGAGTCATGGAAAGCGGTTGTTGCAGCCGATGATGCTCGTTGCTCGGA...

Protein

Download Protein FASTA

583 aa · TkA07G104370|TK1151|PROTEIN

MEEQSIKTPFLKPAEDCKNRKRWRTAIWLFISLTALIFIFLTLSLELEDWKKHNNGKGNKASNKVQSGDEVESWKAVVAADDARCSEIGASILNDGGHAVDAAVAVASCGGVVNPMASGIGGGGFMVVRSSDTSETLAFDFRESAPAAASQNMYANNINNKYSGPLSMGVPGELAGLHKAWSKYGRLPWKSLFQPAIHLAKHGFQVAPYLANSISSSSASIKKDPGLQAVFAPGGKILKAGDTCYNVKLGLSLEAIAEGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G104370`
TK1151 ID	TkA07G104370
OH-1004 ID	LXL04_027914
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 99.314 / OH-1004 93.087 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G104370

Location Chr07:27123702-27134067 (+)

Description Similar to GGT3: Glutathione hydrolase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29210`	May play a role in protecting plants from some xenobiotic chemicals by degrading vacuolar glutathione conjugates into cysteine conjugates.	Glutathione conjugates in the vacuole are degraded by gamma-glutamyl transpeptidase GGT3 in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2006.03005.x
`At4g39650`	May be required for glutathione transport into developing seeds.	No verified direct reference in this release
`At4g39640`	May play a role in preventing oxidative stress by metabolizing extracellular oxidized glutathione (GSSG).	No verified direct reference in this release
`At1g69820`	Putative inactive glutathione hydrolase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027914 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002682 regulation of immune system process Biological Process

GO:0006508 proteolysis Biological Process

GO:0006520 amino acid metabolic process Biological Process

GO:0006536 glutamate metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006691 leukotriene metabolic process Biological Process

GO:0006749 glutathione metabolic process Biological Process

GO:0006750 glutathione biosynthetic process Biological Process

GO:0006751 glutathione catabolic process Biological Process

GO:0006805 xenobiotic metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007283 spermatogenesis Biological Process

KEGG gene cross-reference

ath:AT4G29210

ath:AT4G39640

ath:AT4G39650

mmu:14598

rno:116568

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.458

Rank 1 · TkA07G104370 · TK1151

Extracellular0.175

Rank 2 · TkA07G104370 · TK1151

Cytoplasm0.172

Rank 3 · TkA07G104370 · TK1151

Cell membrane0.172

Rank 4 · TkA07G104370 · TK1151

Endoplasmic reticulum0.122

Rank 5 · TkA07G104370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01019G_glu_transpept85-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G104370	`PF01019`	G_glu_transpept	85	573	2.6e-172	575.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0G0`	Arabidopsis thaliana	sp\|Q9M0G0\|GAGT3_ARATH Glutathione hydrolase 3	63.900%	Swiss-Prot	High
`Q680I5`	Arabidopsis thaliana	sp\|Q680I5\|GAGT2_ARATH Glutathione hydrolase 2	49.700%	Swiss-Prot	Medium
`Q8VYW6`	Arabidopsis thaliana	sp\|Q8VYW6\|GAGT1_ARATH Glutathione hydrolase 1	50.700%	Swiss-Prot	High
`Q9CAR5`	Arabidopsis thaliana	sp\|Q9CAR5\|GAGT4_ARATH Putative inactive glutathione hydrolase 4	57.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card