Gene Card
Gene overview
cDNA / CDS / Protein Sequences
957 bp · TkA07G098460|TK1151|cDNA
ATGCAAGAAAACACTCAAAGAACTTATACGGCTGCTAATGATTTGTTGAATCTTGATTATAACGCAGAAAGTGAGTACGTCATGTGTCCTGGCGAAGAAATCACCATCGCTAAAGGATACTCAAGCATTATAGAATCATTAGCATCTGTTTTACCATCTGGGGTCATTCAATTAGGTAAAAAAGTTTCCAAAATTGAATGGAATCCTGAATGTACAAGACCAGTCACACTACACTTTCTTGATGGTACAACTCTATCAGC...
957 bp · TkA07G098460|TK1151|CDS
ATGCAAGAAAACACTCAAAGAACTTATACGGCTGCTAATGATTTGTTGAATCTTGATTATAACGCAGAAAGTGAGTACGTCATGTGTCCTGGCGAAGAAATCACCATCGCTAAAGGATACTCAAGCATTATAGAATCATTAGCATCTGTTTTACCATCTGGGGTCATTCAATTAGGTAAAAAAGTTTCCAAAATTGAATGGAATCCTGAATGTACAAGACCAGTCACACTACACTTTCTTGATGGTACAACTCTATCAGC...
Protein
Download Protein FASTA318 aa · TkA07G098460|TK1151|PROTEIN
MQENTQRTYTAANDLLNLDYNAESEYVMCPGEEITIAKGYSSIIESLASVLPSGVIQLGKKVSKIEWNPECTRPVTLHFLDGTTLSADHVIVTVSLGVLKAGNLKFNPPLPDYKIEAISRLGYGVVNKLFLQLSPEYTDFDQFPFLQFLFHQSDSEVKDPRIPWWIRRTAFISPIYRKSRVLLSWFAGEEALKLETLSNEVILDEVSTTLSTFLSNSHQECNGNGIKKPSKLKLVKVLKSQWGHDPLFMGSYSYVKVGSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G098460 |
|---|---|
| TK1151 ID | TkA07G098460 |
| OH-1004 ID | LXL04_002430 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 71.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 63.602Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G098460 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:25693720-25694739 (+) | ||||||||||||
| Description | Similar to PAO5: Probable polyamine oxidase 5 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006596 polyamine biosynthetic process Biological Process GO:0006598 polyamine catabolic process Biological Process GO:0006805 xenobiotic metabolic process Biological Process GO:0009446 putrescine biosynthetic process Biological Process GO:0009447 putrescine catabolic process Biological Process GO:0046203 spermidine catabolic process Biological Process GO:0046208 spermine catabolic process Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:1901307 positive regulation of spermidine biosynthetic process Biological Process GO:1903602 thermospermine catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT4G29720 dosa:Os01g0710200 hsa:54498 mmu:212503 mmu:228608 osa:4327828 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01593Amino_oxidase17-311 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G098460 | PF01593 | Amino_oxidase | 17 | 311 | 8.8e-49 | 167.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.