TkA07G097200 | RubberDandelionOmics

Gene overview

TkA07G097200

Reference: TK1151 Chr: Chr07 Coordinates: 25362618-25371011 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2009 bp · TkA07G097200|TK1151|cDNA

CTCAACTCCTATCCATCCATCCGAGACCAGTGAGAAAGAGATAGAAAGCGTAGAACATATTTCGAGATATTTCTCTTCAAAATTTCGTTACTGAGAATAGAAAAAGATACCAATGACGTGAAAGTTCATAATAAAGGAATCATCTGTAGACTAGAAATTTTCATTTGTGATAGCAGAATCAATGGAATGCTTTGCAGCTCGAAACATGACGGCAACAATGGCGGTTTTTACGTGCCCTAGATTCAAGGACTGTAATACCA...

CDS

Download CDS FASTA

1458 bp · TkA07G097200|TK1151|CDS

ATGGAATGCTTTGCAGCTCGAAACATGACGGCAACAATGGCGGTTTTTACGTGCCCTAGATTCAAGGACTGTAATACCAGGCACGATTTTTCGTTACTTAAACATCGAAGACTCACTAGCTTATCAGCGTCGTCTTCGTTGCGGCAAATTAAGTGCAGCGCTAAAAGCGACCGTTGTGTAGTGGACAAACAAGGGATTTCCGTAGAAGACGAAGAAGATTATGTGAAGGCCGGTGGATCGGAACTTCTTTTTGTTCAAAT...

Protein

Download Protein FASTA

485 aa · TkA07G097200|TK1151|PROTEIN

MECFAARNMTATMAVFTCPRFKDCNTRHDFSLLKHRRLTSLSASSSLRQIKCSAKSDRCVVDKQGISVEDEEDYVKAGGSELLFVQMQQTKSMESQSSLSEKLPQIPIGDCILDLVVIGCGPAGLALAAESAKLGLNVGLIGPDLPFTNNYGVWEDEFIGLGLEGCIERVWRDTLVYLDDNDPILIGRAYGRVSRDLLHEELLKRCVESGVSYLSSKVERITEAPNGFSLIECEGNITIPCRLATVASGAASGKLLQYEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G097200`
TK1151 ID	TkA07G097200
OH-1004 ID	LXL04_027852
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.557 / OH-1004 90.189 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G097200

Location Chr07:25362618-25371011 (-)

Description Similar to LUT2: Lycopene epsilon cyclase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57030`	Involved in carotenoid biosynthesis.	Altered xanthophyll compositions adversely affect chlorophyll accumulation and nonphotochemical quenching in Arabidopsis mutants.1998 · DOI: 10.1073/pnas.95.22.13324

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027852 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006744 ubiquinone biosynthetic process Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016123 xanthophyll biosynthetic process Biological Process

GO:1901812 beta-carotene biosynthetic process Biological Process

GO:1901818 beta-zeacarotene biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0016860 intramolecular oxidoreductase activity Molecular Function

KEGG gene cross-reference

ag:CAA60119

ath:AT5G57030

cann:107869983

sly:544104

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA07G097200 · TK1151

Mitochondrion0.034

Rank 2 · TkA07G097200 · TK1151

Cytoplasm0.022

Rank 3 · TkA07G097200 · TK1151

Nucleus0.019

Rank 4 · TkA07G097200 · TK1151

Peroxisome0.014

Rank 5 · TkA07G097200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05834Lycopene_cycl114-478 aa

PF01266DAO114-144 aa

PF07992Pyr_redox_2114-142 aa

PF03486HI0933_like114-141 aa

PF01134GIDA114-143 aa

PF00890FAD_binding_2114-141 aa

PF12831FAD_oxidored114-142 aa

PF13738Pyr_redox_3116-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G097200	`PF05834`	Lycopene_cycl	114	478	8.8e-143	476.7
TkA07G097200	`PF01266`	DAO	114	144	0.00015	22.1
TkA07G097200	`PF07992`	Pyr_redox_2	114	142	0.00067	19.9
TkA07G097200	`PF03486`	HI0933_like	114	141	0.0022	18.2
TkA07G097200	`PF01134`	GIDA	114	143	0.017	14.9
TkA07G097200	`PF00890`	FAD_binding_2	114	141	0.02	14.8
TkA07G097200	`PF12831`	FAD_oxidored	114	142	0.2	11.6
TkA07G097200	`PF13738`	Pyr_redox_3	116	138	0.29	11.1
TkA07G097200	`PF01266`	DAO	191	280	0.00015	22.1
TkA07G097200	`PF07992`	Pyr_redox_2	199	252	0.00067	19.9
TkA07G097200	`PF03486`	HI0933_like	200	252	0.0022	18.2
TkA07G097200	`PF22454`	PQQ_syn_pqqF_N_2	418	460	0.05	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38932`	Arabidopsis thaliana	sp\|Q38932\|LCYE_ARATH Lycopene epsilon cyclase, chloroplastic	71.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card