TkA07G088860 | RubberDandelionOmics

Gene overview

TkA07G088860

Reference: TK1151 Chr: Chr07 Coordinates: 23140671-23153099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2311 bp · TkA07G088860|TK1151|cDNA

TTGATCAAAGAGAACGGAATTGATGTATTGAGCATACCACCAACAAGATTGGAAGAAAACGAGGACGTGAATTATGATGCGGTGACAACCGCGGTTAAAAAAGCACTCCGATTAAACCGTGCTATTCAAGCAAAAGATGGTCATTGGCCTGCAGAAAATGCTGGCCCTATGTTTTTCACTCCTCCGCTTCTTATTGCTATGTACATTAGTGGAGCCATAGATACACATTTAACCAAAGAACACAAGGCAGAAATGATACG...

CDS

Download CDS FASTA

1929 bp · TkA07G088860|TK1151|CDS

TTGATCAAAGAGAACGGAATTGATGTATTGAGCATACCACCAACAAGATTGGAAGAAAACGAGGACGTGAATTATGATGCGGTGACAACCGCGGTTAAAAAAGCACTCCGATTAAACCGTGCTATTCAAGCAAAAGATGGTCATTGGCCTGCAGAAAATGCTGGCCCTATGTTTTTCACTCCTCCGCTTCTTATTGCTATGTACATTAGTGGAGCCATAGATACACATTTAACCAAAGAACACAAGGCAGAAATGATACG...

Protein

Download Protein FASTA

642 aa · TkA07G088860|TK1151|PROTEIN

LIKENGIDVLSIPPTRLEENEDVNYDAVTTAVKKALRLNRAIQAKDGHWPAENAGPMFFTPPLLIAMYISGAIDTHLTKEHKAEMIRYIYNHQNEDGGWGFYIEGHSTMIGSALSYVALRLLGEGPNDGDGAVTQAREWILQHRGATSIPSWGKTYLSMLGVYEWDGCNPLPPEFWLFPEPLPFHPAKMWCYCRTTYMPMSYLYGKKVHGPITDLVLQLRQEIHPIPYDKINWNKQRHNCCKVDLYYPHSTLQNLLWDGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G088860`
TK1151 ID	TkA07G088860
OH-1004 ID	LXL04_027526
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.200
Protein coverage (%)	TK1151 97.664 / OH-1004 78.967 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G088860`
Location	Chr07:23140671-23153099 (+)
Description	Similar to DDS: Dammarenediol II synthase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027526` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0010038 response to metal ion Biological Process GO:0016104 triterpenoid biosynthetic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0019745 pentacyclic triterpenoid biosynthetic process Biological Process GO:1902438 response to vanadate(3-) Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005811 lipid droplet Cellular Component GO:0016829 lyase activity Molecular Function GO:0042300 beta-amyrin synthase activity Molecular Function
KEGG gene cross-reference	ag:BAB83088 ag:BAF33291 sly:100529102 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.383

Rank 1 · TkA07G088860 · TK1151

Endoplasmic reticulum0.226

Rank 2 · TkA07G088860 · TK1151

Cytoplasm0.126

Rank 3 · TkA07G088860 · TK1151

Peroxisome0.086

Rank 4 · TkA07G088860 · TK1151

Cell membrane0.071

Rank 5 · TkA07G088860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13243SQHop_cyclase_C23-103 aa

PF13249SQHop_cyclase_N35-293 aa

PF13243SQHop_cyclase_C73-144 aa

PF00432Prenyltrans73-123 aa

PF09492Pec_lyase84-101 aa

PF13243SQHop_cyclase_C347-628 aa

PF00432Prenyltrans440-593 aa

PF09492Pec_lyase510-545 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G088860	`PF13243`	SQHop_cyclase_C	23	103	7.6e-41	140.9
TkA07G088860	`PF13249`	SQHop_cyclase_N	35	293	2.2e-40	139.4
TkA07G088860	`PF13243`	SQHop_cyclase_C	73	144	7.6e-41	140.9
TkA07G088860	`PF00432`	Prenyltrans	73	123	9.6e-05	22.7
TkA07G088860	`PF09492`	Pec_lyase	84	101	0.18	11.8
TkA07G088860	`PF13243`	SQHop_cyclase_C	347	628	7.6e-41	140.9
TkA07G088860	`PF00432`	Prenyltrans	440	593	9.6e-05	22.7
TkA07G088860	`PF09492`	Pec_lyase	510	545	0.18	11.8
TkA07G088860	`PF13249`	SQHop_cyclase_N	520	546	2.2e-40	139.4
TkA07G088860	`PF09492`	Pec_lyase	570	591	0.18	11.8
TkA07G088860	`PF13249`	SQHop_cyclase_N	571	592	2.2e-40	139.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card