Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2336 bp · TkA07G081720|TK1151|cDNA
AGAAAGGGTGAGAGAGAGAGAAAGAAAGAGGAAGACTTGGGGTTGGGGGTTTGATATACAGGTAATCAAGAACGCATAATCTTTACTGTACATTAACAATCAGTTTCTGATTATTTGATCTTTGATAACTACGTATACAATTGTTAATTGAATCATGTATGCATAAATCTATACATATATGTATGCTTTCCAATTTCATGACTCAACTGCATCGACCAGCTTCGTATTGATTAAGACATCTGAAGGTATTCTATGTGGCC...
852 bp · TkA07G081720|TK1151|CDS
ATGCCATCACTAGAGAGGAAGATGAAGTCAACCATGGGCTGTTTAAGAGAAAAGAACGGCCTCCATGTGTGCCAAAAATCCAACAAAATCTCCAAAAATTCATCATCACATACCAGAAACTTCCAACAAGAACCACAACTTAACACTTCAGATTCTTTCTCCAGTGAATCAAATGTGCAAGAACTTAGAACCAATGAAACTAACTGCTGTGAACTTCTAGAAGAAGAATCTACCTTTTCACCTAACTCAGACTCCATTGA...
Protein
Download Protein FASTA283 aa · TkA07G081720|TK1151|PROTEIN
MPSLERKMKSTMGCLREKNGLHVCQKSNKISKNSSSHTRNFQQEPQLNTSDSFSSESNVQELRTNETNCCELLEEESTFSPNSDSIDNDSEATGSSNEGTEIQKPLETTSMEDNNKQYQSCNVSDFFISDMSVSTPPIPSDTTCLPDYGCDESTIFFDDDYLILPFLEDSIDTSKENLDDDDNDDDDGIRNRLEPVMVSEESGLYLAIHQLKSCNQEIEVNNIYPEWDPAECLDPQMFVRNLPDLSQVERKTVTLALDLD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G081720 |
|---|---|
| TK1151 ID | TkA07G081720 |
| OH-1004 ID | LXL04_027633 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 98.587 / OH-1004 65.728Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G081720 |
|---|---|
| Location | Chr07:21355526-21359210 (-) |
| Description | Similar to ctdspl2: CTD small phosphatase-like protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006470 protein dephosphorylation Biological Process GO:0045722 positive regulation of gluconeogenesis Biological Process GO:0046827 positive regulation of protein export from nucleus Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0004721 phosphoprotein phosphatase activity Molecular Function GO:0004722 protein serine/threonine phosphatase activity Molecular Function GO:0008420 RNA polymerase II CTD heptapeptide repeat phosphatase activity Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0290365 dre:558181 hsa:51496 mmu:329506 rno:311368 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03031NIF254-278 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G081720 | PF03031 | NIF | 254 | 278 | 0.0048 | 17.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.