TkA07G081580 | RubberDandelionOmics

Gene overview

TkA07G081580

Reference: TK1151 Chr: Chr07 Coordinates: 21326364-21332537 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3604 bp · TkA07G081580|TK1151|cDNA

CTTATCTCTCTCTCAATCATTCCCTGAAGTTTTTTCACTTGTTCATCCAATCACAACTTTCTCTCTCTACATATAGATACACGATATATGTATCTATAGATTCCGTACGTCTTTTTGTGTTGTGCTTTTTTTTTTTCCTAGAGAGAGAAAAACAGAGACACACATACATACACACACTTCTCTCCCCTCACGCCTCCACTATTTCTCTATCTAAAAGCAAGAAACTTTCTCTCTCTGTCACCCGATCATGGAGATGATGT...

CDS

Download CDS FASTA

576 bp · TkA07G081580|TK1151|CDS

ATGGGAATGTTGAATGGGAATGGGAATGGGAATCAGAGTGATAGCAAGAAACAGTTCCAGTTGGATCTTGAGAAGATCACAAATGGGGAAGATACTCGAACCACTTTGATGATTAAAAACATTCCAAACAAGTATACTTCAAAGATGCTGCTGGCTGCCATTGATGAAAATCATAGTGGAACTTATGATTTTCTTTACCTACCCATTGATTTCAAGAACAAATGCAATGTCGGGTATGCATTTATCAACATGCTTTCTCC...

Protein

Download Protein FASTA

191 aa · TkA07G081580|TK1151|PROTEIN

MGMLNGNGNGNQSDSKKQFQLDLEKITNGEDTRTTLMIKNIPNKYTSKMLLAAIDENHSGTYDFLYLPIDFKNKCNVGYAFINMLSPTHIIPFYQAFNGKKWEKFNSEKVASLAYARIQGKMALVTHFQNSSLMNEDKRCRPILFHSEGSDVTDQEPLSTNSLNIQMHRSNGSDSGDSSGSPPKDGAADQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G081580`
TK1151 ID	TkA07G081580
OH-1004 ID	LXL04_022408
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.000
Protein coverage (%)	TK1151 88.482 / OH-1004 24.539 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G081580

Location Chr07:21326364-21332537 (+)

Description Similar to ML2: Protein MEI2-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29400`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At5g07290`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0719800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0517531`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os05g0102800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022408 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29400

ath:AT2G42890

dosa:Os02g0319100

dosa:Os02g0719800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.621

Rank 1 · TkA07G081580 · TK1151

Cytoplasm0.362

Rank 2 · TkA07G081580 · TK1151

Cell membrane0.087

Rank 3 · TkA07G081580 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA07G081580 · TK1151

Mitochondrion0.034

Rank 5 · TkA07G081580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07576BRAP232-109 aa

PF04059RRM_233-129 aa

PF03467Smg4_UPF333-121 aa

PF00076RRM_136-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G081580	`PF07576`	BRAP2	32	109	0.051	14.5
TkA07G081580	`PF04059`	RRM_2	33	129	1.2e-55	186.4
TkA07G081580	`PF03467`	Smg4_UPF3	33	121	0.0048	17.7
TkA07G081580	`PF00076`	RRM_1	36	101	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWF5`	Arabidopsis thaliana	sp\|Q8VWF5\|AML5_ARATH Protein MEI2-like 5	76.800%	Swiss-Prot	High
`Q9LYN7`	Arabidopsis thaliana	sp\|Q9LYN7\|AML4_ARATH Protein MEI2-like 4	74.200%	Swiss-Prot	High
`Q6ZI17`	Oryza sativa subsp. japonica	sp\|Q6ZI17\|OML2_ORYSJ Protein MEI2-like 2	82.100%	Swiss-Prot	High
`Q64M78`	Oryza sativa subsp. japonica	sp\|Q64M78\|OML4_ORYSJ Protein MEI2-like 4	83.100%	Swiss-Prot	High
`Q75M35`	Oryza sativa subsp. japonica	sp\|Q75M35\|OML3_ORYSJ Protein MEI2-like 3	77.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card