TkA07G080510 | RubberDandelionOmics

Gene overview

TkA07G080510

Reference: TK1151 Chr: Chr07 Coordinates: 21049125-21050454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

977 bp · TkA07G080510|TK1151|cDNA

AAATAAAAATGGTTTTCCAATATTTGTTTGGCAGAAAGAAATACACTTCTTCACACCGCTCTTTTTATACCCGATCCAGAACTCATGACATTTTCATAACCTGATAGTGATCGCAATCGCTCTCTTCGCATCTCAATTTCCTATCAAACAAATCTTATAGTTTTCTTTCTTATCGTTCATAATCAATCCGGGATTCCGGTCTACTTTCTCTTCGTTTTTGCAGGTTTTGTTTCTGTTTCTGTTTCAGTCGCTCGACATGG...

CDS

Download CDS FASTA

546 bp · TkA07G080510|TK1151|CDS

ATGGCCTCTTCATCAATCGTAATCAAGGTCGATTTTGGGGAAACACTCAGGCGATTCAATGCATCTATCAACGACAAGAAACTTGCTCTCGGCTTTGAAGCTTTAAGGACAAAGATCCGTAATCTCTTCAACTTCAGTTCTGATGCTGCTTTTACTCTCACCTACGTTGATGAAGATGGAGATGCTGTTACTCTTGCTGCTGACGATGATCTTAATGACGTCGTGCGACAGGGTCTGAACCCATTAAGACTTACTGTCAA...

Protein

Download Protein FASTA

181 aa · TkA07G080510|TK1151|PROTEIN

MASSSIVIKVDFGETLRRFNASINDKKLALGFEALRTKIRNLFNFSSDAAFTLTYVDEDGDAVTLAADDDLNDVVRQGLNPLRLTVKLEKGNPIGSIGTSSTPMRSPEPQLPFGPFPTGLSEFLKSMPEPIRDQLTKLPLELASKTTSSTPVISELAQKLTAAYLKQNSGSMAAPRANTQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G080510`
TK1151 ID	TkA07G080510
OH-1004 ID	LXL04_027629
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G080510

Location Chr07:21049125-21050454 (+)

Description Similar to JOKA2: Protein JOKA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24690`	Autophagic substrate degraded in the vacuole by non-selective autophagy.	Plant NBR1 is a selective autophagy substrate and a functional hybrid of the mammalian autophagic adapters NBR1 and p62/SQSTM1.2011 · DOI: 10.4161/auto.7.9.16389 NBR1-mediated selective autophagy targets insoluble ubiquitinated protein aggregates in plant stress responses.2013 · DOI: 10.1371/journal.pgen.1003196 E3 ubiquitin ligase CHIP and NBR1-mediated selective autophagy protect additively against proteotoxicity in plant stress responses.2014 · DOI: 10.1371/journal.pgen.1004116

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006914 autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051258 protein polymerization Biological Process

GO:0071211 protein targeting to vacuole involved in autophagy Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005776 autophagosome Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0043130 ubiquitin binding Molecular Function

KEGG gene cross-reference

ath:AT4G24690

sot:102582603

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.588

Rank 1 · TkA07G080510 · TK1151

Nucleus0.430

Rank 2 · TkA07G080510 · TK1151

Cell membrane0.077

Rank 3 · TkA07G080510 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA07G080510 · TK1151

Mitochondrion0.066

Rank 5 · TkA07G080510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00564PB16-86 aa

PF07196Flagellin_IN21-26 aa

PF07196Flagellin_IN51-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G080510	`PF00564`	PB1	6	86	3.4e-11	43.7
TkA07G080510	`PF07196`	Flagellin_IN	21	26	0.067	14.1
TkA07G080510	`PF07196`	Flagellin_IN	51	76	0.067	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB64`	Arabidopsis thaliana	sp\|Q9SB64\|NBR1_ARATH Protein NBR1 homolog	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card