TkA07G079110 | RubberDandelionOmics

Gene overview

TkA07G079110

Reference: TK1151 Chr: Chr07 Coordinates: 20672962-20676134 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1515 bp · TkA07G079110|TK1151|cDNA

ATCAAGAGCATGAGTGGATTGCACTCCAAAAATATGGACGATGAACAGATAAAGAAGGACGAATACCATAAACAGGAGGAAGTCATGCAACTGTCCACAATTTGTGCAAGGAACAAGATAATGTTCCAGATAGATGTGCAATCTGGATCTTCCCCAAAGAAAGTCGCAGCAAAGGCGGCCAAAAGCTTGAGCCTGACATGGGTCGTACTTGACAGGCAGATGAAGAAAGACAGAAAGTACTTTATGGAGAATCTTACATG...

CDS

Download CDS FASTA

1506 bp · TkA07G079110|TK1151|CDS

ATGAGTGGATTGCACTCCAAAAATATGGACGATGAACAGATAAAGAAGGACGAATACCATAAACAGGAGGAAGTCATGCAACTGTCCACAATTTGTGCAAGGAACAAGATAATGTTCCAGATAGATGTGCAATCTGGATCTTCCCCAAAGAAAGTCGCAGCAAAGGCGGCCAAAAGCTTGAGCCTGACATGGGTCGTACTTGACAGGCAGATGAAGAAAGACAGAAAGTACTTTATGGAGAATCTTACATGTGGAATATT...

Protein

Download Protein FASTA

502 aa · TkA07G079110|TK1151|PROTEIN

MSGLHSKNMDDEQIKKDEYHKQEEVMQLSTICARNKIMFQIDVQSGSSPKKVAAKAAKSLSLTWVVLDRQMKKDRKYFMENLTCGILRMKRDNRVEKLRGPIIMEDKKLRSLRRTSSNEHVSYGEMIPVMSKRELSLKKTPNAQKPTYKLEGGDRRFAPPRDKPQLSSSPPSTDQTSPTASKASTSSFGASEVSTMNSSFTYDGQQEEFEYSVCSVCQNKRPSIRLKKDFVYAELYQATNGFSKNNFLSEGGFGSVYEGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G079110`
TK1151 ID	TkA07G079110
OH-1004 ID	LXL04_027620
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 86.403 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G079110

Location Chr07:20672962-20676134 (+)

Description Similar to PERK3: Proline-rich receptor-like protein kinase PERK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At3g24540`	Proline-rich receptor-like protein kinase PERK3.	No verified direct reference in this release
`At1g07870`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g28590`	May be involved in plant defense signaling.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027620 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G07870

ath:AT1G52290

ath:AT2G28590

ath:AT5G38560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.553

Rank 1 · TkA07G079110 · TK1151

Cytoplasm0.330

Rank 2 · TkA07G079110 · TK1151

Nucleus0.288

Rank 3 · TkA07G079110 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA07G079110 · TK1151

Golgi apparatus0.030

Rank 5 · TkA07G079110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase244-502 aa

PF07714PK_Tyr_Ser-Thr245-452 aa

PF03109ABC1253-275 aa

PF17667Pkinase_fungal352-432 aa

PF03109ABC1354-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G079110	`PF00069`	Pkinase	244	502	5.6e-41	141.4
TkA07G079110	`PF07714`	PK_Tyr_Ser-Thr	245	452	2.3e-43	149.1
TkA07G079110	`PF03109`	ABC1	253	275	0.017	15.0
TkA07G079110	`PF17667`	Pkinase_fungal	352	432	0.022	14.2
TkA07G079110	`PF03109`	ABC1	354	390	0.017	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	45.400%	Swiss-Prot	Medium
`Q1PEM5`	Arabidopsis thaliana	sp\|Q1PEM5\|PERK3_ARATH Proline-rich receptor-like protein kinase PERK3	46.100%	Swiss-Prot	Medium
`Q9LQQ8`	Arabidopsis thaliana	sp\|Q9LQQ8\|PBL5_ARATH Probable serine/threonine-protein kinase PBL5	42.500%	Swiss-Prot	Medium
`Q9SIB6`	Arabidopsis thaliana	sp\|Q9SIB6\|PBL6_ARATH Probable serine/threonine-protein kinase PBL6	44.100%	Swiss-Prot	Medium
`Q9C821`	Arabidopsis thaliana	sp\|Q9C821\|PEK15_ARATH Proline-rich receptor-like protein kinase PERK15	45.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card