TkA07G078830 | RubberDandelionOmics

Gene overview

TkA07G078830

Reference: TK1151 Chr: Chr07 Coordinates: 20540424-20542747 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1680 bp · TkA07G078830|TK1151|cDNA

AAAAAACTCTTTTCGCAGTTTTTCTATAATGTTTTTGAATAACCAGTTAAAACAACTGAATTCTCCTGTAACCCAATAACAATTTTAATTATTAGATGTTATATAAATACTTATTTAGATACGGTTAGGGTATATAAAACGATAAACTAGTAAAATACCCTGAAAAGTAAATGCTTGATTGCGAGTAGAATTTGGTAGTCTAACTAAAAGTAGCTTTATTTTTTCTAAAATGCTAGTGGCTTTTTCCCTTTCTTTAGTCC...

CDS

Download CDS FASTA

1059 bp · TkA07G078830|TK1151|CDS

ATGATCACCACCATGGATAATAAACCAAATAAGCAAGAAACCCCATCTCCCCTCCCCAATAAAGATCATGATTCCTCCCCTAGAAAGCCCCCACCTGCCTCCGCCTCCGTCGCCGGCGGTAGCGGCGGAGATAGGTTGAAAAGAGACGAGTGGAGTGAAGGGGCGGTTTCGAGTCTCCTAGAAGCTTATGAAGCCAAGTGGGTGCTTCGTAATCGAGCCAAGCTAAAGGGCCATGACTGGGAAGATGTGGCGAAATACGT...

Protein

Download Protein FASTA

352 aa · TkA07G078830|TK1151|PROTEIN

MITTMDNKPNKQETPSPLPNKDHDSSPRKPPPASASVAGGSGGDRLKRDEWSEGAVSSLLEAYEAKWVLRNRAKLKGHDWEDVAKYVSSRVNSSKSPKTQTQCKNKIESMKKRYRSESATADVSSWPLFPRLDLLLRGSGGPPPVVTTVASGGDPPSSSTPVASNLPLLVFEHTPAPQPPPLPPMIHSSSPPVTLPVPLPVPTPVRQVIRQNSIDSNGVDRENKVGVKMCENQVAEKMEIETDCSTPALYSNDKGNIQTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G078830`
TK1151 ID	TkA07G078830
OH-1004 ID	LXL04_027614
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G078830

Location Chr07:20540424-20542747 (-)

Description Similar to ASIL2: Trihelix transcription factor ASIL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05550`	Probable transcription regulator (By similarity).	No verified direct reference in this release
`At3g11100`	Transcription regulator.	Interaction of Arabidopsis Trihelix-Domain Transcription Factors VFP3 and VFP5 with Agrobacterium Virulence Protein VirF.2015 · DOI: 10.1371/journal.pone.0142128
`At3g14180`	Transcription regulator that may repress the maturation program during early embryogenesis.	MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355
`At1g54060`	Transcription repressor that binds specific DNA sequence such as the GT-box-like motif 5'-CGTGATT-3' in the AT2S3 promoter.	Repression of seed maturation genes by a trihelix transcriptional repressor in Arabidopsis seedlings.2009 · DOI: 10.1105/tpc.108.061309 MicroRNAs regulate the timing of embryo maturation in Arabidopsis.2011 · DOI: 10.1104/pp.110.171355 ASIL1 is required for proper timing of seed filling in Arabidopsis.2011 · DOI: 10.4161/psb.6.12.18709

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027614 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042393 histone binding Molecular Function

KEGG gene cross-reference

ath:AT3G11100

ath:AT3G14180

ath:AT5G05550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · TkA07G078830 · TK1151

Cytoplasm0.057

Rank 2 · TkA07G078830 · TK1151

Cell membrane0.024

Rank 3 · TkA07G078830 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA07G078830 · TK1151

Plastid0.010

Rank 5 · TkA07G078830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_448-134 aa

PF12776Myb_DNA-bind_358-117 aa

PF10545MADF_DNA_bdg73-132 aa

PF04504GeBP-like_DBD77-119 aa

PF10545MADF_DNA_bdg260-284 aa

PF12776Myb_DNA-bind_3266-266 aa

PF13837Myb_DNA-bind_4268-276 aa

PF04504GeBP-like_DBD275-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G078830	`PF13837`	Myb_DNA-bind_4	48	134	1.6e-15	58.0
TkA07G078830	`PF12776`	Myb_DNA-bind_3	58	117	0.12	14.1
TkA07G078830	`PF10545`	MADF_DNA_bdg	73	132	0.02	15.9
TkA07G078830	`PF04504`	GeBP-like_DBD	77	119	0.0067	17.8
TkA07G078830	`PF10545`	MADF_DNA_bdg	260	284	0.02	15.9
TkA07G078830	`PF12776`	Myb_DNA-bind_3	266	266	0.12	14.1
TkA07G078830	`PF13837`	Myb_DNA-bind_4	268	276	1.6e-15	58.0
TkA07G078830	`PF04504`	GeBP-like_DBD	275	300	0.0067	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFG0`	Arabidopsis thaliana	sp\|Q9FFG0\|ENAP2_ARATH Trihelix transcription factor ENAP2	40.000%	Swiss-Prot	Low
`Q8VZI9`	Arabidopsis thaliana	sp\|Q8VZI9\|ENAP1_ARATH Trihelix transcription factor ENAP1	42.200%	Swiss-Prot	Low
`Q9LJG8`	Arabidopsis thaliana	sp\|Q9LJG8\|ASIL2_ARATH Trihelix transcription factor ASIL2	38.300%	Swiss-Prot	Low
`Q9SYG2`	Arabidopsis thaliana	sp\|Q9SYG2\|ASIL1_ARATH Trihelix transcription factor ASIL1	35.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card