RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G075140
Reference: TK1151 Chr: Chr07 Coordinates: 19645047-19649035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2694 bp · TkA07G075140|TK1151|cDNA

ATTTTCACAACACAAATCCATTCATACTCTTTATTCATAAAAAAATTAATTCATCTTATTCATCTTTGCCGCAAAATCTTCACAGATCTGAAGAATGGAGTCGACTTCGCACCTGGAACGAATGGGCGAAGAACTCAAGTGTCCCATCTGCTTAAGTCTCCTGAAATCCGCGGTCTCGCTTACGTGCAATCACATATTTTGCAATATTTGCATCGACAAATCTATGAGGTCCGATTCAACTTGTCCTGTATGCAAAATCC...

CDS

Download CDS FASTA

2421 bp · TkA07G075140|TK1151|CDS

ATGGAGTCGACTTCGCACCTGGAACGAATGGGCGAAGAACTCAAGTGTCCCATCTGCTTAAGTCTCCTGAAATCCGCGGTCTCGCTTACGTGCAATCACATATTTTGCAATATTTGCATCGACAAATCTATGAGGTCCGATTCAACTTGTCCTGTATGCAAAATCCCTTACCGGCGAAGAGAGATTCGTCCTGCACCTCACATGGATTCTTTAGTGAACATTTACAAGAGCATGGAAGTTTCATCTGGAGTCAACATACT...

Protein

Download Protein FASTA

806 aa · TkA07G075140|TK1151|PROTEIN

MESTSHLERMGEELKCPICLSLLKSAVSLTCNHIFCNICIDKSMRSDSTCPVCKIPYRRREIRPAPHMDSLVNIYKSMEVSSGVNILVTQTEPHPSGKENQVNDTNKASRTTPNTQNQKKCKGKALKGLSKKLKRQNSDPVGPSFPIKKRVQVPEHYPQETPTRPVNPESGKKERTQTNVAGIEDAAHLNENKEQLFSPFFWLRNEEDIDETVEPTPLDPLTVSQPNDPCFSDIKDSPDDHSSHVTSKDDGIFDSEMFEW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G075140
TK1151 IDTkA07G075140
OH-1004 IDLXL04_027587
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G075140
LocationChr07:19645047-19649035 (+)
DescriptionSimilar to BRCA1: Protein BREAST CANCER SUSCEPTIBILITY 1 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g21070 Plays a role in DNA repair and in cell-cycle control.
A homologue of the breast cancer-associated gene BARD1 is involved in DNA repair in plants.2006 · DOI: 10.1038/sj.emboj.7601313
At1g04020 Binds specifically to H3K4me3 regions of target genes (e.g. WUS and WOX5) promoters to repress their transcription via chromatin remodeling.
A homologue of the breast cancer-associated gene BARD1 is involved in DNA repair in plants.2006 · DOI: 10.1038/sj.emboj.7601313
Mutation of Arabidopsis BARD1 causes meristem defects by failing to confine WUSCHEL expression to the organizing center.2008 · DOI: 10.1105/tpc.108.058867
ROW1 maintains quiescent centre identity by confining WOX5 expression to specific cells.2015 · DOI: 10.1038/ncomms7003

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027587 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000724 double-strand break repair via homologous recombination Biological Process
GO:0006281 DNA repair Biological Process
GO:0006282 regulation of DNA repair Biological Process
GO:0006310 DNA recombination Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006974 DNA damage response Biological Process
GO:0009934 regulation of meristem structural organization Biological Process
GO:0010078 maintenance of root meristem identity Biological Process
GO:0010332 response to gamma radiation Biological Process
GO:0010492 maintenance of shoot apical meristem identity Biological Process
GO:0035825 homologous recombination Biological Process
GO:0042325 regulation of phosphorylation Biological Process
KEGG gene cross-reference
ath:AT4G21070
mmu:12021
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933
Rank 1 · TkA07G075140 · TK1151
Cytoplasm0.158
Rank 2 · TkA07G075140 · TK1151
Mitochondrion0.023
Rank 3 · TkA07G075140 · TK1151
Cell membrane0.022
Rank 4 · TkA07G075140 · TK1151
Golgi apparatus0.010
Rank 5 · TkA07G075140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13771zf-HC5HC2H5-38 aa
PF14835zf-RING_68-71 aa
PF13920zf-C3HC4_313-58 aa
PF16685zf-RING_1014-78 aa
PF13923zf-C3HC4_215-53 aa
PF13639zf-RING_215-54 aa
PF14634zf-RING_515-54 aa
PF12678zf-rbx115-54 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G075140PF13771zf-HC5HC2H5381.9e-0835.1
TkA07G075140PF14835zf-RING_68711.9e-0628.4
TkA07G075140PF13920zf-C3HC4_313586.1e-0729.9
TkA07G075140PF16685zf-RING_1014780.0003921.2
TkA07G075140PF13923zf-C3HC4_215535.1e-1039.7
TkA07G075140PF13639zf-RING_215543.8e-0834.2
TkA07G075140PF14634zf-RING_515546.6e-0626.7
TkA07G075140PF12678zf-rbx115540.002918.5
TkA07G075140PF00097zf-C3HC416531.2e-0732.2
TkA07G075140PF13445zf-RING_UBOX16512e-0628.4
TkA07G075140PF15227zf-C3HC4_416532.3e-0628.3
TkA07G075140PF13832zf-HC5HC2H_216400.0004221.2
TkA07G075140PF00533BRCT801254.5e-1556.3
TkA07G075140PF13771zf-HC5HC2H4034421.9e-0835.1
TkA07G075140PF13832zf-HC5HC2H_24244440.0004221.2
TkA07G075140PF00097zf-C3HC44304391.2e-0732.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8RXD4Arabidopsis thalianasp|Q8RXD4|BRCA1_ARATH Protein BREAST CANCER SUSCEPTIBILITY 1 homolog40.700%Swiss-ProtMedium
F4I443Arabidopsis thalianasp|F4I443|BARD1_ARATH BRCA1-associated RING domain protein 142.700%Swiss-ProtLow

JBrowse

View in Genome Browser