TkA07G073270 | RubberDandelionOmics

Gene overview

TkA07G073270

Reference: TK1151 Chr: Chr07 Coordinates: 19214465-19215311 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

462 bp · TkA07G073270|TK1151|cDNA

ATGGCGACGACCTCCACCGTAAAGCGGCTGTCTGCAGTGGAGAAATCTCCAAATTGGCTGGAAATGCCTGACGAACTGATGGCAAATATACTTAAAAGACTGGGAGATGTAGAAATACTCAACAACGCAGTGAAAGTTTGCACAACATGGCGGAGAATTGGTAGGGATCCTGCGATGTGGAAGGTCATTAATCTGCACAAACCGGTTAGGGCTCGGAATGCTAATTACGATTTTCATCGGCTGACTAAGGAGGCAGTCCG...

CDS

Download CDS FASTA

462 bp · TkA07G073270|TK1151|CDS

ATGGCGACGACCTCCACCGTAAAGCGGCTGTCTGCAGTGGAGAAATCTCCAAATTGGCTGGAAATGCCTGACGAACTGATGGCAAATATACTTAAAAGACTGGGAGATGTAGAAATACTCAACAACGCAGTGAAAGTTTGCACAACATGGCGGAGAATTGGTAGGGATCCTGCGATGTGGAAGGTCATTAATCTGCACAAACCGGTTAGGGCTCGGAATGCTAATTACGATTTTCATCGGCTGACTAAGGAGGCAGTCCG...

Protein

Download Protein FASTA

153 aa · TkA07G073270|TK1151|PROTEIN

MATTSTVKRLSAVEKSPNWLEMPDELMANILKRLGDVEILNNAVKVCTTWRRIGRDPAMWKVINLHKPVRARNANYDFHRLTKEAVRLSCGELINISLEGFGNDNLLHHVVSRSSKPNSLCLTNCNNITGSGLNDALKTLLEKDKSNTGIEYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G073270`
TK1151 ID	TkA07G073270
OH-1004 ID	LXL04_027567
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.400
Protein coverage (%)	TK1151 94.771 / OH-1004 48.026 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G073270

Location Chr07:19214465-19215311 (-)

Description Similar to SKIP19: F-box protein SKIP19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05460`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05500`	Putative F-box/LRR-repeat protein 23.	No verified direct reference in this release
`At4g05475`	Putative F-box protein At4g05475.	No verified direct reference in this release
`At4g05497`	Putative F-box/LRR-repeat protein 9.	No verified direct reference in this release
`At4g05470`	Putative F-box/LRR-repeat protein 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT4G05460

ath:AT4G05475

ath:AT4G05497

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.578

Rank 1 · TkA07G073270 · TK1151

Cytoplasm0.393

Rank 2 · TkA07G073270 · TK1151

Cell membrane0.079

Rank 3 · TkA07G073270 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA07G073270 · TK1151

Mitochondrion0.032

Rank 5 · TkA07G073270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like19-65 aa

PF00646F-box19-61 aa

PF29594LRR_SKP285-141 aa

PF00646F-box87-98 aa

PF00646F-box104-113 aa

PF12937F-box-like106-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G073270	`PF12937`	F-box-like	19	65	7.6e-09	35.9
TkA07G073270	`PF00646`	F-box	19	61	8.6e-08	32.5
TkA07G073270	`PF29594`	LRR_SKP2	85	141	0.085	12.8
TkA07G073270	`PF00646`	F-box	87	98	8.6e-08	32.5
TkA07G073270	`PF00646`	F-box	104	113	8.6e-08	32.5
TkA07G073270	`PF12937`	F-box-like	106	121	7.6e-09	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0U9`	Arabidopsis thaliana	sp\|Q9M0U9\|SKI19_ARATH F-box protein SKIP19	40.000%	Swiss-Prot	Medium
`Q9S9V9`	Arabidopsis thaliana	sp\|Q9S9V9\|FBL23_ARATH Putative F-box/LRR-repeat protein 23	38.700%	Swiss-Prot	Medium
`Q9M0U7`	Arabidopsis thaliana	sp\|Q9M0U7\|FB221_ARATH Putative F-box protein At4g05475	38.200%	Swiss-Prot	Medium
`Q9S9V8`	Arabidopsis thaliana	sp\|Q9S9V8\|FBL9_ARATH Putative F-box/LRR-repeat protein 9	36.500%	Swiss-Prot	Medium
`Q9M0U8`	Arabidopsis thaliana	sp\|Q9M0U8\|FBL21_ARATH Putative F-box/LRR-repeat protein 21	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card