TkA07G072990 | RubberDandelionOmics

Gene overview

TkA07G072990

Reference: TK1151 Chr: Chr07 Coordinates: 19132654-19137610 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1573 bp · TkA07G072990|TK1151|cDNA

GTTTTTCTTAAAGAACTTTGTCTCGTGAACATAGATTCGGAACGATTTTCTTAGGAGGTCTTCTCGTGGAATACCATTTTTCTAGGAAAGCGCTAGGAAAGGTGAGTTTCTAAGGAAAATCGCCCTAAGAAACCTTGTGATTTTGTAGTTGCATATGGTTCTTTCAACTTGCACTAGTTCGGAGGTCATGATTCATGAACCTCTCTGAATCCTCGTTGCTTCTACTTTTGCTATATATCGGTAAAGTTATTCATCAATTT...

CDS

Download CDS FASTA

837 bp · TkA07G072990|TK1151|CDS

ATGATGGAATCTCCAAATTGGCTGGATATGCCTGACGAATTGATGGTAAGTATATTCCAAAGATTGCCTAGTGTAGAAGTACTCAAGAGCACACGGAAAGTATGTACAACTTGGGGGAGAATTTGCAACTATCCAGCGATATGGACAGTCATTAATATGCTTAAACGGCCTGTTGATGCTTGGGGTTGGGATCACGGTCTAGAGGCGCCGACTAAGGAGGCAGTCGATCTTAGCTGTGGGGAGTTAATCGATATCAGTAT...

Protein

Download Protein FASTA

278 aa · TkA07G072990|TK1151|PROTEIN

MMESPNWLDMPDELMVSIFQRLPSVEVLKSTRKVCTTWGRICNYPAIWTVINMLKRPVDAWGWDHGLEAPTKEAVDLSCGELIDISIQAFCTDELLNHIVLHSNKLKRLCLVSCFKITDSVLSLAVKSVTKLEELHLVRTYINAQDLEVIGRNCPQFKSFKMSKLRTWTFNNDHALAIANNMPELRHLELVDSAMENDGLEAVLNGCPHLETLHLCHCHSLDLDGYLGKLCRERIKEFKHHSSSLGLFCDDEDFCEEDVY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G072990`
TK1151 ID	TkA07G072990
OH-1004 ID	LXL04_027560
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.800
Protein coverage (%)	TK1151 96.403 / OH-1004 94.681 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G072990

Location Chr07:19132654-19137610 (+)

Description Similar to FBL23: Putative F-box/LRR-repeat protein 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05500`	Putative F-box/LRR-repeat protein 23.	No verified direct reference in this release
`At4g05460`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05490`	Putative F-box/LRR-repeat protein 22.	No verified direct reference in this release
`At4g05475`	Putative F-box protein At4g05475.	No verified direct reference in this release
`At4g05470`	Putative F-box/LRR-repeat protein 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027560 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT4G05460

ath:AT4G05475

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.531

Rank 1 · TkA07G072990 · TK1151

Nucleus0.523

Rank 2 · TkA07G072990 · TK1151

Cell membrane0.072

Rank 3 · TkA07G072990 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA07G072990 · TK1151

Plastid0.036

Rank 5 · TkA07G072990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box7-48 aa

PF12937F-box-like7-49 aa

PF13855LRR_817-28 aa

PF13516LRR_674-90 aa

PF13855LRR_875-109 aa

PF29594LRR_SKP277-223 aa

PF23622LRR_At1g61320_AtMIF190-174 aa

PF25372LRR_FBXL1592-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G072990	`PF00646`	F-box	7	48	6e-08	33.0
TkA07G072990	`PF12937`	F-box-like	7	49	1.2e-07	32.1
TkA07G072990	`PF13855`	LRR_8	17	28	0.0014	19.1
TkA07G072990	`PF13516`	LRR_6	74	90	1.5	9.7
TkA07G072990	`PF13855`	LRR_8	75	109	0.0014	19.1
TkA07G072990	`PF29594`	LRR_SKP2	77	223	3.5e-07	30.5
TkA07G072990	`PF23622`	LRR_At1g61320_AtMIF1	90	174	0.0039	17.3
TkA07G072990	`PF25372`	LRR_FBXL15	92	163	0.00075	18.7
TkA07G072990	`PF00646`	F-box	93	102	6e-08	33.0
TkA07G072990	`PF12937`	F-box-like	93	113	1.2e-07	32.1
TkA07G072990	`PF24758`	LRR_At5g56370	95	163	2e-13	51.3
TkA07G072990	`PF00560`	LRR_1	96	109	3.8	8.8
TkA07G072990	`PF13516`	LRR_6	102	119	1.5	9.7
TkA07G072990	`PF12799`	LRR_4	105	140	4.2e-05	24.4
TkA07G072990	`PF13516`	LRR_6	130	139	1.5	9.7
TkA07G072990	`PF13855`	LRR_8	131	142	0.0014	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9V9`	Arabidopsis thaliana	sp\|Q9S9V9\|FBL23_ARATH Putative F-box/LRR-repeat protein 23	42.900%	Swiss-Prot	Medium
`Q9M0U9`	Arabidopsis thaliana	sp\|Q9M0U9\|SKI19_ARATH F-box protein SKIP19	41.600%	Swiss-Prot	Medium
`Q9M0U6`	Arabidopsis thaliana	sp\|Q9M0U6\|FBL22_ARATH Putative F-box/LRR-repeat protein 22	41.800%	Swiss-Prot	Medium
`Q9M0U7`	Arabidopsis thaliana	sp\|Q9M0U7\|FB221_ARATH Putative F-box protein At4g05475	39.200%	Swiss-Prot	Medium
`Q9M0U8`	Arabidopsis thaliana	sp\|Q9M0U8\|FBL21_ARATH Putative F-box/LRR-repeat protein 21	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card