TkA07G061300 | RubberDandelionOmics

Gene overview

TkA07G061300

Reference: TK1151 Chr: Chr07 Coordinates: 16242780-16246475 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2539 bp · TkA07G061300|TK1151|cDNA

ATTTTATGAGTTGCATAAGAATACCATTTAGGTCATATCAGTAAATCCAATCTAACCGATCTAAAATAAAACCCTTTCAATCTTCAATTTGTCTTGCGGTCGTAACTCGTAAGAAGCTTCATCTCTGCGTTGACTTGCGATTTTACACAACTTCAAGTCTTCAACGCTAATCGTCATCCCAAGTCTCTCGCTAGACTGGATTCGATCATTCCATCTCCCTATTCTTACGTTAATACATAAATTATATAGTAACACAGATC...

CDS

Download CDS FASTA

1296 bp · TkA07G061300|TK1151|CDS

ATGTCGTCTAAAACATTGCCCTACTCCATCAAAGACATACAATACGATAACGCCAAGTTTCGTCGACGATCCTTGGTCCAGGTCATTTCACAAACTTTTCTGACCAAAAAAATGAAACGTGAATGTATGACATGTAGTACAGGAAAGATTCTAGCCATATTAATGATCTTTGGCCTAACATATCTTGTGCTCACTCATGCAAGTCCAATCCAATCTGTAACTAGATCCATTGGATCTAAAGAAGGAGACAACTCCATCAT...

Protein

Download Protein FASTA

431 aa · TkA07G061300|TK1151|PROTEIN

MSSKTLPYSIKDIQYDNAKFRRRSLVQVISQTFLTKKMKRECMTCSTGKILAILMIFGLTYLVLTHASPIQSVTRSIGSKEGDNSIIDGGNGGIGVKRFWRKPPRLPPHLSPDELNITNKSTTTNLESKWAERQQSVKNAFVHAWTGYKTHAMGYDELMPLTQKGVDGLGGLGATVIDALDTAMIMNLDNVVHEAGSWIEKNLPERILKKGQVNLFETTIRVVGGLLSAYHLSTSNPKNGDLPKPSVYLENAKNLADVLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G061300`
TK1151 ID	TkA07G061300
OH-1004 ID	LXL04_027483
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 94.664 / OH-1004 65.280 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G061300

Location Chr07:16242780-16246475 (-)

Description Similar to MNS3: Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30000`	Class I alpha-mannosidase essential for early N-glycan processing.	Class I alpha-mannosidases are required for N-glycan processing and root development in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.109.072363
`At1g51590`	Class I alpha-mannosidase essential for early N-glycan processing.	Two Arabidopsis thaliana Golgi alpha-mannosidase I enzymes are responsible for plant N-glycan maturation.2010 · DOI: 10.1093/glycob/cwp170 Class I alpha-mannosidases are required for N-glycan processing and root development in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.109.072363
`At3g21160`	Class I alpha-mannosidase essential for early N-glycan processing.	Two Arabidopsis thaliana Golgi alpha-mannosidase I enzymes are responsible for plant N-glycan maturation.2010 · DOI: 10.1093/glycob/cwp170 Class I alpha-mannosidases are required for N-glycan processing and root development in Arabidopsis thaliana.2009 · DOI: 10.1105/tpc.109.072363

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027483 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006491 N-glycan processing Biological Process

GO:0009311 oligosaccharide metabolic process Biological Process

GO:0019082 viral protein processing Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0036510 trimming of terminal mannose on C branch Biological Process

GO:0140277 endoplasmic reticulum N-glycan trimming Biological Process

GO:1904380 endoplasmic reticulum mannose trimming Biological Process

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G30000

hsa:11253

mmu:227619

rno:499751

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.521

Rank 1 · TkA07G061300 · TK1151

Golgi apparatus0.339

Rank 2 · TkA07G061300 · TK1151

Cytoplasm0.084

Rank 3 · TkA07G061300 · TK1151

Lysosome / Vacuole0.053

Rank 4 · TkA07G061300 · TK1151

Cell membrane0.051

Rank 5 · TkA07G061300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01532Glyco_hydro_47140-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G061300	`PF01532`	Glyco_hydro_47	140	430	4.9e-82	277.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y37`	Arabidopsis thaliana	sp\|Q93Y37\|MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3	61.300%	Swiss-Prot	High
`Q9C512`	Arabidopsis thaliana	sp\|Q9C512\|MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1	43.400%	Swiss-Prot	Medium
`Q8H116`	Arabidopsis thaliana	sp\|Q8H116\|MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2	41.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card