TkA07G060270 | RubberDandelionOmics

Gene overview

TkA07G060270

Reference: TK1151 Chr: Chr07 Coordinates: 15967015-15970024 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1616 bp · TkA07G060270|TK1151|cDNA

GACACGATTTCCTTTCGTTACCACTACTCCCCCCTGGTCGCCACTTTTCCGCTACGATTGAAAGAAGAACTCGCCGGCTGCTTTCAGAGTTATCAAAATGGTGAAGATCCTCTTACCAGGCTCCAAAAAAAGACAAGATCCACCTGAAATACTAGAGGGTCAACATAAAAAAAAGCAGAAAATGGATAATGGTGTCAAAATAGAATGCTTAAAGATTCTCAAAACCTTGATGACTCATAAATTCGGACCCATTTTCAATC...

CDS

Download CDS FASTA

660 bp · TkA07G060270|TK1151|CDS

ATGGTGAAGATCCTCTTACCAGGCTCCAAAAAAAGACAAGATCCACCTGAAATACTAGAGGGTCAACATAAAAAAAAGCAGAAAATGGATAATGGTGTCAAAATAGAATGCTTAAAGATTCTCAAAACCTTGATGACTCATAAATTCGGACCCATTTTCAATCAACCCGTGGACCCCGCTGAGCTCTGTATCCCTGATTATTTCTTGATAATCTCTCATCCCATGGATTTGGGCACAATTTACAACAAATTACAAGACAA...

Protein

Download Protein FASTA

219 aa · TkA07G060270|TK1151|PROTEIN

MVKILLPGSKKRQDPPEILEGQHKKKQKMDNGVKIECLKILKTLMTHKFGPIFNQPVDPAELCIPDYFLIISHPMDLGTIYNKLQDNIYSLPESFANDIRLTFSNAMRYNPPKNSVHLMAKELNDLFNKIWKSIESKLTKPIKKVGEKVKVSKPVKKQGVSASVGVNVGVKVKKSEDIVNKGSSCSEGKTLMTFDEKMRIKKDLMVALEVRLVDLYVAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G060270`
TK1151 ID	TkA07G060270
OH-1004 ID	LXL04_006059
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.300
Protein coverage (%)	TK1151 47.032 / OH-1004 14.052 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G060270

Location Chr07:15967015-15970024 (+)

Description Similar to GTE9: Transcription factor GTE9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46550`	Transcription factor GTE12.	No verified direct reference in this release
`At5g14270`	Transcription factor GTE9.	No verified direct reference in this release
`UniProt: Q9FGW9`	Acts as a negative regulator in plant response to changes in environmental conditions through the control of ABA-regulated gene expression.	No verified direct reference in this release
`At3g01770`	Transcription factor GTE11.	No verified direct reference in this release
`At3g27260`	Transcription factor GTE8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006059 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051365 cellular response to potassium ion starvation Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G73150

ath:AT3G01770

ath:AT3G27260

ath:AT5G14270

ath:AT5G63320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.947

Rank 1 · TkA07G060270 · TK1151

Cytoplasm0.126

Rank 2 · TkA07G060270 · TK1151

Cell membrane0.020

Rank 3 · TkA07G060270 · TK1151

Mitochondrion0.015

Rank 4 · TkA07G060270 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA07G060270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00439Bromodomain37-121 aa

PF08385DHC_N193-153 aa

PF00834Ribul_P_3_epim114-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G060270	`PF00439`	Bromodomain	37	121	1.3e-21	77.0
TkA07G060270	`PF08385`	DHC_N1	93	153	0.093	12.1
TkA07G060270	`PF00834`	Ribul_P_3_epim	114	181	0.11	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS28`	Arabidopsis thaliana	sp\|Q9LS28\|GTE12_ARATH Transcription factor GTE12	51.200%	Swiss-Prot	Medium
`Q93YS6`	Arabidopsis thaliana	sp\|Q93YS6\|GTE9_ARATH Transcription factor GTE9	40.800%	Swiss-Prot	Medium
`Q9FGW9`	Arabidopsis thaliana	sp\|Q9FGW9\|GTE10_ARATH Transcription factor GTE10	40.600%	Swiss-Prot	Medium
`Q93ZB7`	Arabidopsis thaliana	sp\|Q93ZB7\|GTE11_ARATH Transcription factor GTE11	37.900%	Swiss-Prot	Medium
`Q9LK27`	Arabidopsis thaliana	sp\|Q9LK27\|GTE8_ARATH Transcription factor GTE8	48.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card