TkA07G059800 | RubberDandelionOmics

Gene overview

TkA07G059800

Reference: TK1151 Chr: Chr07 Coordinates: 15839949-15841357 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · TkA07G059800|TK1151|cDNA

ATGATGACTTCCAGCGATAAAGCTCCCGATGCGATGCCGACGGGCGACGGATCTGTCCCGCCGGGAAAACCCATGACGGTGGGAGATCAAGTTCTCGACAAAAGTGCTCAGATTCTGCAATCTTTGAAGCCCATTAAACAAATGAGCATGCATGCCTGCACCTTCAACGTTTACAGCCATGACATGAGTCGACAGATCGAGGCTCATCATTACATCACTCGCCTGAATCAAGATTTCCTCCAATGCGCCGTTTACGACTC...

CDS

Download CDS FASTA

750 bp · TkA07G059800|TK1151|CDS

ATGATGACTTCCAGCGATAAAGCTCCCGATGCGATGCCGACGGGCGACGGATCTGTCCCGCCGGGAAAACCCATGACGGTGGGAGATCAAGTTCTCGACAAAAGTGCTCAGATTCTGCAATCTTTGAAGCCCATTAAACAAATGAGCATGCATGCCTGCACCTTCAACGTTTACAGCCATGACATGAGTCGACAGATCGAGGCTCATCATTACATCACTCGCCTGAATCAAGATTTCCTCCAATGCGCCGTTTACGACTC...

Protein

Download Protein FASTA

249 aa · TkA07G059800|TK1151|PROTEIN

MMTSSDKAPDAMPTGDGSVPPGKPMTVGDQVLDKSAQILQSLKPIKQMSMHACTFNVYSHDMSRQIEAHHYITRLNQDFLQCAVYDSDDPSAHLIGVEYIVSDRIFDTLSTDEQKLWHSHDHEVTSGLWVCPGVPEMLNRTELENLAHTYGKFWCTWQVDRGDRLPLGAPALMMSPQVVNMGVVQPELVRVRDNKYKISTDELRKSRADIPVSKPGNARASDFWMQNGKGYAIDIENAEMKRLEGPKFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G059800`
TK1151 ID	TkA07G059800
OH-1004 ID	LXL04_027444
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G059800

Location Chr07:15839949-15841357 (+)

Description Similar to OBAP2A: Oil body-associated protein 2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45690`	Oil body-associated protein 2A.	No verified direct reference in this release
`At4g18920`	Oil body-associated protein 2B.	No verified direct reference in this release
`At1g29680`	Oil body-associated protein 2C.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027444 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G29680

ath:AT4G18920

ath:AT5G45690

zma:100274115

zma:100286341

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · TkA07G059800 · TK1151

Nucleus0.481

Rank 2 · TkA07G059800 · TK1151

Mitochondrion0.087

Rank 3 · TkA07G059800 · TK1151

Cell membrane0.069

Rank 4 · TkA07G059800 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA07G059800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06884DUF126443-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G059800	`PF06884`	DUF1264	43	210	1.7e-69	233.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941A4`	Arabidopsis thaliana	sp\|Q941A4\|OBP2A_ARATH Oil body-associated protein 2A	59.400%	Swiss-Prot	High
`Q1PE68`	Arabidopsis thaliana	sp\|Q1PE68\|OBP2B_ARATH Oil body-associated protein 2B	55.100%	Swiss-Prot	High
`Q9C7N3`	Arabidopsis thaliana	sp\|Q9C7N3\|OBP2C_ARATH Oil body-associated protein 2C	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card