TkA07G058720 | RubberDandelionOmics

Gene overview

TkA07G058720

Reference: TK1151 Chr: Chr07 Coordinates: 15551712-15553841 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1852 bp · TkA07G058720|TK1151|cDNA

AATGGAACAACGCAATTCTGAATCAATATTCGAAAACATCAACAACAGTAACATGTTAATGGAATTCCACGACGCCATTGAGGATTTACCATTTGTCAATGTCTCACATGCCATTGATTCCGATCAATTCCTCTCTGGTTCCGAGCATGATAGCAGCATCGACGGCGAATCTACAGTTCATGTTCTATCTGAGCACACGCCTGACTCTCCAGCATCTCTCTCCTCTTCTGGTCTCCGTCGTCGTCGACCTCATGCTTCAC...

CDS

Download CDS FASTA

1695 bp · TkA07G058720|TK1151|CDS

ATGGAACAACGCAATTCTGAATCAATATTCGAAAACATCAACAACAGTAACATGTTAATGGAATTCCACGACGCCATTGAGGATTTACCATTTGTCAATGTCTCACATGCCATTGATTCCGATCAATTCCTCTCTGGTTCCGAGCATGATAGCAGCATCGACGGCGAATCTACAGTTCATGTTCTATCTGAGCACACGCCTGACTCTCCAGCATCTCTCTCCTCTTCTGGTCTCCGTCGTCGTCGACCTCATGCTTCACA...

Protein

Download Protein FASTA

564 aa · TkA07G058720|TK1151|PROTEIN

MEQRNSESIFENINNSNMLMEFHDAIEDLPFVNVSHAIDSDQFLSGSEHDSSIDGESTVHVLSEHTPDSPASLSSSGLRRRRPHASHAIDSDQFLSGSEHDSSIDGESTVHVLSEHTPDSPASLSSSGLRRRRPASHRSSEDFSQSQFFINNPDGLIDFDRRSLTGSQRKKYRRSWSDRTGSQSVGRDGSQLQSDITSIGSNGAITSVGSNGAITRVGSNGRRPDDESITSNSKNSSSILLLTLAELLLKALRFQNQLFA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G058720`
TK1151 ID	TkA07G058720
OH-1004 ID	LXL04_027432
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G058720

Location Chr07:15551712-15553841 (-)

Description Similar to SEI2: Seipin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34380`	Involved in lipid metabolism and lipid droplet (LD) morphology, number, and size.	No verified direct reference in this release
`At1g29760`	Involved in lipid metabolism and lipid droplet (LD) morphology, number, and size.	No verified direct reference in this release
`At5g16460`	Involved in lipid metabolism and lipid droplet (LD) morphology, number, and size.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0019915 lipid storage Biological Process

GO:0034389 lipid droplet organization Biological Process

GO:0043086 negative regulation of catalytic activity Biological Process

GO:0048316 seed development Biological Process

GO:0048515 spermatid differentiation Biological Process

GO:0050995 negative regulation of lipid catabolic process Biological Process

GO:0061725 cytosolic lipolysis Biological Process

GO:0080155 regulation of double fertilization forming a zygote and endosperm Biological Process

KEGG gene cross-reference

ath:AT1G29760

ath:AT2G34380

ath:AT5G16460

rno:361722

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.523

Rank 1 · TkA07G058720 · TK1151

Nucleus0.202

Rank 2 · TkA07G058720 · TK1151

Golgi apparatus0.171

Rank 3 · TkA07G058720 · TK1151

Cytoplasm0.130

Rank 4 · TkA07G058720 · TK1151

Cell membrane0.118

Rank 5 · TkA07G058720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04569DUF59176-86 aa

PF04569DUF591127-137 aa

PF16218Peptidase_C101257-296 aa

PF06775Seipin322-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G058720	`PF04569`	DUF591	76	86	1.5	9.7
TkA07G058720	`PF04569`	DUF591	127	137	1.5	9.7
TkA07G058720	`PF16218`	Peptidase_C101	257	296	0.14	12.3
TkA07G058720	`PF06775`	Seipin	322	535	9.8e-43	147.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L615`	Arabidopsis thaliana	sp\|Q8L615\|SEI3_ARATH Seipin-3	39.400%	Swiss-Prot	Medium
`F4I340`	Arabidopsis thaliana	sp\|F4I340\|SEI2_ARATH Seipin-2	35.300%	Swiss-Prot	Medium
`Q9FFD9`	Arabidopsis thaliana	sp\|Q9FFD9\|SEI1_ARATH Seipin-1	29.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card