TkA07G057730 | RubberDandelionOmics

Gene overview

TkA07G057730

Reference: TK1151 Chr: Chr07 Coordinates: 15327781-15328158 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkA07G057730|TK1151|cDNA

ATGCCTGTTGAGTTTCGATTATTGAAGAAATTACGAGTTCTTCGAATCGGAGATAATTTGTTGACGGGAGAAATTATCGAAAGTATTGGGGAGTTGATTGTTGAAGTCACTTCAGTTACAGACGATTTGGGGGTAGAGAACGAGATAAACCTTGGTGGGTGTTGTGAGCTTGATTTTAAGCAAGATCCAGAGACTGTAGCCATTGAAGATGCTGTCAAAGTTCTCCTAGAAGGCTTGGGTGAAGACATTAACAGAGAAGG...

CDS

Download CDS FASTA

303 bp · TkA07G057730|TK1151|CDS

ATGCCTGTTGAGTTTCGATTATTGAAGAAATTACGAGTTCTTCGAATCGGAGATAATTTGTTGACGGGAGAAATTATCGAAAGTATTGGGGAGTTGATTGTTGAAGTCACTTCAGTTACAGACGATTTGGGGGTAGAGAACGAGATAAACCTTGGTGGGTGTTGTGAGCTTGATTTTAAGCAAGATCCAGAGACTGTAGCCATTGAAGATGCTGTCAAAGTTCTCCTAGAAGGCTTGGGTGAAGACATTAACAGAGAAGG...

Protein

Download Protein FASTA

100 aa · TkA07G057730|TK1151|PROTEIN

MPVEFRLLKKLRVLRIGDNLLTGEIIESIGELIVEVTSVTDDLGVENEINLGGCCELDFKQDPETVAIEDAVKVLLEGLGEDINREGMQIHMLCMRSTCD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G057730`
TK1151 ID	TkA07G057730
OH-1004 ID	LXL04_011277
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 77.000 / OH-1004 33.772 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G057730

Location Chr07:15327781-15328158 (-)

Description Similar to GSO1: LRR receptor-like serine/threonine-protein kinase GSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07270`	GTP cyclohydrolase 1 is the first enzyme in the biosynthetic pathway leading to folic acid.	Folate synthesis in plants: the first step of the pterin branch is mediated by a unique bimodular GTP cyclohydrolase I.2002 · DOI: 10.1073/pnas.192278499

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011277 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0048226 Casparian strip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G20140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.371

Rank 1 · TkA07G057730 · TK1151

Nucleus0.345

Rank 2 · TkA07G057730 · TK1151

Cell membrane0.183

Rank 3 · TkA07G057730 · TK1151

Endoplasmic reticulum0.094

Rank 4 · TkA07G057730 · TK1151

Plastid0.075

Rank 5 · TkA07G057730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00560LRR_110-32 aa

PF00560LRR_148-55 aa

PF22605IBR_284-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G057730	`PF00560`	LRR_1	10	32	0.053	14.3
TkA07G057730	`PF00560`	LRR_1	48	55	0.053	14.3
TkA07G057730	`PF22605`	IBR_2	84	100	0.025	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFV7`	Arabidopsis thaliana	sp\|Q9SFV7\|GCH1_ARATH GTP cyclohydrolase 1	56.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card