TkA07G057510 | RubberDandelionOmics

Gene overview

TkA07G057510

Reference: TK1151 Chr: Chr07 Coordinates: 15273149-15273634 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkA07G057510|TK1151|cDNA

ATGAGAGATTTCATTGATGAAGAAGCTCGATTAAATCAGCATGAATCAAGAAATTCGAAAACGGGTTTAACGGAATCGGTAAGAAATGTTGTTTTGGAAAACAAACCTAAGATCATGCTAAAGAACGAGAAACGAAGAAGAAGGTCAAAGCAAGGTGGTGTAGTCAACGCTCATTCTTCAAGAACACGACCTAGGGTTGAATGCAGAATCAAAGCGTTTGAAAACATGAAGAGAAGGAGGTTGAAGATGAAGGAGATGAA...

CDS

Download CDS FASTA

486 bp · TkA07G057510|TK1151|CDS

ATGAGAGATTTCATTGATGAAGAAGCTCGATTAAATCAGCATGAATCAAGAAATTCGAAAACGGGTTTAACGGAATCGGTAAGAAATGTTGTTTTGGAAAACAAACCTAAGATCATGCTAAAGAACGAGAAACGAAGAAGAAGGTCAAAGCAAGGTGGTGTAGTCAACGCTCATTCTTCAAGAACACGACCTAGGGTTGAATGCAGAATCAAAGCGTTTGAAAACATGAAGAGAAGGAGGTTGAAGATGAAGGAGATGAA...

Protein

Download Protein FASTA

161 aa · TkA07G057510|TK1151|PROTEIN

MRDFIDEEARLNQHESRNSKTGLTESVRNVVLENKPKIMLKNEKRRRRSKQGGVVNAHSSRTRPRVECRIKAFENMKRRRLKMKEMNAFCISLDCNAIVKSSFDPETDFRESMMEMMIEKGVMQREKLEELLFCYLTLNCDEYHRLIVKVFQETYNQYVNL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G057510`
TK1151 ID	TkA07G057510
OH-1004 ID	LXL04_034395
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.400
Protein coverage (%)	TK1151 67.081 / OH-1004 41.328 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G057510

Location Chr07:15273149-15273634 (+)

Description Similar to OFP5: Transcription repressor OFP5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18830`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.2005 · DOI: 10.1073/pnas.0501181102 Cell-fate switch of synergid to egg cell in Arabidopsis eostre mutant embryo sacs arises from misexpression of the BEL1-like homeodomain gene BLH1.2007 · DOI: 10.1105/tpc.107.054890 Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development.2011 · DOI: 10.1371/journal.pone.0023896
`At5g58360`	Transcriptional repressor that may regulate multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release
`At5g01840`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins.2005 · DOI: 10.1073/pnas.0501181102 Arabidopsis Ovate Family Protein 1 is a transcriptional repressor that suppresses cell elongation.2007 · DOI: 10.1111/j.1365-313x.2007.03096.x OVATE FAMILY PROTEIN4 (OFP4) interaction with KNAT7 regulates secondary cell wall formation in Arabidopsis thaliana.2011 · DOI: 10.1111/j.1365-313x.2011.04595.x Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development.2011 · DOI: 10.1371/journal.pone.0023896
`At3g52525`	Transcriptional repressor that regulates multiple aspects of plant growth and development through the regulation of BEL1-LIKE (BLH) and KNOX TALE (KNAT) homeodomain transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034395 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0071548 response to dexamethasone Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0030863 cortical cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT1G06920

ath:AT2G30400

ath:AT4G18830

ath:AT5G01840

ath:AT5G58360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.467

Rank 1 · TkA07G057510 · TK1151

Nucleus0.393

Rank 2 · TkA07G057510 · TK1151

Cell membrane0.271

Rank 3 · TkA07G057510 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA07G057510 · TK1151

Plastid0.042

Rank 5 · TkA07G057510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04844Ovate102-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G057510	`PF04844`	Ovate	102	155	1.9e-21	76.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZN1`	Arabidopsis thaliana	sp\|Q8VZN1\|OFP5_ARATH Transcription repressor OFP5	39.400%	Swiss-Prot	Medium
`Q9LVL4`	Arabidopsis thaliana	sp\|Q9LVL4\|OFP3_ARATH Transcription repressor OFP3	55.900%	Swiss-Prot	Low
`Q9LZW2`	Arabidopsis thaliana	sp\|Q9LZW2\|OFP1_ARATH Transcription repressor OFP1	54.400%	Swiss-Prot	Low
`Q3EAL1`	Arabidopsis thaliana	sp\|Q3EAL1\|OFP6_ARATH Transcription repressor OFP6	43.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card