TkA07G052600 | RubberDandelionOmics

Gene overview

TkA07G052600

Reference: TK1151 Chr: Chr07 Coordinates: 13997989-13998472 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · TkA07G052600|TK1151|cDNA

ATGAATCTCTTTATGGCAATTACTATTCTTGTTAGCAAATCTCGTTCCTGGGCACTCACTAAGGAGAATCTTTTGTTCCTTGAGGCCTGTAGAACAATTGATCGTGCATATGTTGACAAAAGCTTCAGTGGTCAAAGCTGGTTTAGGTACAGAGGAAATGCACTAAGAAACGAACCAATGAACAACCGTGAACAAACATGTAAGAGTATGATTTCACGCCTAATTTTTCATCGCGCTATCACTGTTCCTCATCCTCTCGA...

CDS

Download CDS FASTA

387 bp · TkA07G052600|TK1151|CDS

ATGAATCTCTTTATGGCAATTACTATTCTTGTTAGCAAATCTCGTTCCTGGGCACTCACTAAGGAGAATCTTTTGTTCCTTGAGGCCTGTAGAACAATTGATCGTGCATATGTTGACAAAAGCTTCAGTGGTCAAAGCTGGTTTAGGTACAGAGGAAATGCACTAAGAAACGAACCAATGAACAACCGTGAACAAACATGTAAGAGTATGATTTCACGCCTAATTTTTCATCGCGCTATCACTGTTCCTCATCCTCTCGA...

Protein

Download Protein FASTA

128 aa · TkA07G052600|TK1151|PROTEIN

MNLFMAITILVSKSRSWALTKENLLFLEACRTIDRAYVDKSFSGQSWFRYRGNALRNEPMNNREQTCKSMISRLIFHRAITVPHPLDRDSRHNAQQLPLSCNRLCRVKKIKLEKCLKHFIVWLKNIKF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G052600`
TK1151 ID	TkA07G052600
OH-1004 ID	LXL04_033325
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.200
Protein coverage (%)	TK1151 57.812 / OH-1004 12.602 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G052600

Location Chr07:13997989-13998472 (-)

Description Similar to CTPA2: Carboxyl-terminal-processing peptidase 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17740`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

ag:AAC49799

ath:AT3G57680

ath:AT4G17740

syn:slr0008

syp:SYNPCC7002_A0843

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA07G052600 · TK1151

Mitochondrion0.345

Rank 2 · TkA07G052600 · TK1151

Nucleus0.296

Rank 3 · TkA07G052600 · TK1151

Cell membrane0.084

Rank 4 · TkA07G052600 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA07G052600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23614`	Arabidopsis thaliana	sp\|O23614\|CTPA2_ARATH Carboxyl-terminal-processing peptidase 2, chloroplastic	71.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card